14 products were found matching "GeneID 80829"!
No results were found for the filter!
Anti-ZFP91
Item number: ATA-HPA074591.100
Polyclonal Antibody against Human ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Validated applications: IHC, Uniprot ID: Q96JP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-ZFP91, Anti-Zfp-91, Anti-FKSG11, Anti-ZNF757, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
477.00€
*
E3 ubiquitin-protein ligase ZFP91 (ZFP91), partial,...
Item number: CSB-EP842694HU1.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 242-570aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: ETPKPRRKSG KVKEEKEKKE IKVEVEVEVK EEENEIREDE EPPRKRGRRR KDDKSPRLPK RRKKPPIQYV RCEMEGCGTV LAHPRYLQHH IKYQHLLKKK YVCPHPSCGR LFRLQKQLLR HAKHHTDQRD...
| Keywords: | ZFP91, FKSG11, Zfp-91, ZNF757, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 51.5 kD |
From 292.00€
*
Anti-ZFP91
Item number: CSB-PA504466.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS, pH 7.4, containing 0.02% sodium azide as Preservative and 50% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit serum by affinity-chromatography using specific...
| Keywords: | Anti-ZFP91, Anti-ZNF757, Anti-Zfp-91, Anti-FKSG11, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 126.00€
*
Anti-ZFP91
Item number: A303-245A
Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys- 63'-linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non- canonical NF-kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
| Keywords: | Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 178.00€
*
Anti-ZFP91
Item number: G-PACO07289.50
ZFP91 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. ZFP91 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked...
| Keywords: | Anti-ZFP91, Anti-ZNF757, Anti-Zfp-91, Anti-FKSG11, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
341.00€
*
Anti-ZFP91
Item number: ATA-HPA024037.100
Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
| Keywords: | Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 239.00€
*
Anti-ZFP91
Item number: ATA-HPA065325.100
Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
| Keywords: | Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | ICC, ChIP |
| Host: | Rabbit |
| Species reactivity: | human |
From 358.00€
*
ZFP91 PrEST Antigen
Item number: ATA-APrEST95746.100
PrEST Antigen ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Antigen sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Atypical E3...
| Keywords: | ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein... |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*
ZFP91 (human), recombinant protein
Item number: ABS-PP-10306.100
| Keywords: | E3 ubiquitin-protein ligase ZFP91, RING-type E3 ubiquitin transferase ZFP91, Zinc finger protein 757, Zinc finger protein... |
| MW: | 16 kD |
From 90.00€
*
ZFP91 (Vector pUC, Accession No. BC051743)
Item number: CSB-CL842694HU.10
Length: 1710 Sequence: atgccggggg agacggaaga gccgagaccc ccggagcagc aggaccagga agggggagag gcggccaagg cggctccgga ggagccccaa caacggcccc ctgaggcgat cgcggcggcg cctgcaggga ccactagcag ccgcgtgctg aggggaggtc gggaccgagg ccgggccgct gcggccgccg ccgccgcagc tgtgtcccgc cggaggaagg ccgagtatcc ccgccggcgg aggagcagcc ccagcgccag...
| Keywords: | ZFP91, Zfp-91, ZNF757, FKSG11, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
627.00€
*
Anti-ZFP91, ID (ZFP91, ZNF757, E3 ubiquitin-protein...
Item number: 044071.200
The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in...
| Keywords: | Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=6.3.2.-, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
767.00€
*
ZFP91 PrEST Antigen
Item number: ATA-APrEST73788.100
Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
| Keywords: | ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
265.00€
*