14 products were found matching "GeneID 80829"!

1 from 2 pages
No results were found for the filter!
Anti-ZFP91
Anti-ZFP91

Item number: ATA-HPA074591.100

Polyclonal Antibody against Human ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Validated applications: IHC, Uniprot ID: Q96JP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: Anti-ZFP91, Anti-Zfp-91, Anti-FKSG11, Anti-ZNF757, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: IHC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
E3 ubiquitin-protein ligase ZFP91 (ZFP91), partial, human, recombinant
E3 ubiquitin-protein ligase ZFP91 (ZFP91), partial,...

Item number: CSB-EP842694HU1.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 242-570aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: ETPKPRRKSG KVKEEKEKKE IKVEVEVEVK EEENEIREDE EPPRKRGRRR KDDKSPRLPK RRKKPPIQYV RCEMEGCGTV LAHPRYLQHH IKYQHLLKKK YVCPHPSCGR LFRLQKQLLR HAKHHTDQRD...
Keywords: ZFP91, FKSG11, Zfp-91, ZNF757, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 51.5 kD
From 292.00€ *
Review
Anti-ZFP91
Anti-ZFP91

Item number: CSB-PA504466.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS, pH 7.4, containing 0.02% sodium azide as Preservative and 50% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit serum by affinity-chromatography using specific...
Keywords: Anti-ZFP91, Anti-ZNF757, Anti-Zfp-91, Anti-FKSG11, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
From 126.00€ *
Review
Anti-ZFP91
Anti-ZFP91

Item number: A303-245A

Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys- 63'-linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non- canonical NF-kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
Keywords: Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: WB, IP
Host: Rabbit
Species reactivity: human
From 178.00€ *
Review
Anti-ZFP91
Anti-ZFP91

Item number: G-PACO07289.50

ZFP91 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. ZFP91 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked...
Keywords: Anti-ZFP91, Anti-ZNF757, Anti-Zfp-91, Anti-FKSG11, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
341.00€ *
Review
Anti-ZFP91
Anti-ZFP91

Item number: ATA-HPA024037.100

Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
Keywords: Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: IHC
Host: Rabbit
Species reactivity: human
From 239.00€ *
Review
Anti-ZFP91
Anti-ZFP91

Item number: ATA-HPA065325.100

Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
Keywords: Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=2.3.2.27, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: ICC, ChIP
Host: Rabbit
Species reactivity: human
From 358.00€ *
Review
ZFP91 PrEST Antigen
ZFP91 PrEST Antigen

Item number: ATA-APrEST95746.100

PrEST Antigen ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Antigen sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Atypical E3...
Keywords: ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein...
Expressed in: E.coli
Origin: human
265.00€ *
Review
ZFP91 (human), recombinant protein
ZFP91 (human), recombinant protein

Item number: ABS-PP-10306.100

Keywords: E3 ubiquitin-protein ligase ZFP91, RING-type E3 ubiquitin transferase ZFP91, Zinc finger protein 757, Zinc finger protein...
MW: 16 kD
From 90.00€ *
Review
ZFP91 (Vector pUC, Accession No. BC051743)
ZFP91 (Vector pUC, Accession No. BC051743)

Item number: CSB-CL842694HU.10

Length: 1710 Sequence: atgccggggg agacggaaga gccgagaccc ccggagcagc aggaccagga agggggagag gcggccaagg cggctccgga ggagccccaa caacggcccc ctgaggcgat cgcggcggcg cctgcaggga ccactagcag ccgcgtgctg aggggaggtc gggaccgagg ccgggccgct gcggccgccg ccgccgcagc tgtgtcccgc cggaggaagg ccgagtatcc ccgccggcgg aggagcagcc ccagcgccag...
Keywords: ZFP91, Zfp-91, ZNF757, FKSG11, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein...
Application: Molecular biology, clone
Species reactivity: human
627.00€ *
Review
Anti-ZFP91, ID (ZFP91, ZNF757, E3 ubiquitin-protein ligase ZFP91, Zinc finger protein 757, Zinc fing
Anti-ZFP91, ID (ZFP91, ZNF757, E3 ubiquitin-protein...

Item number: 044071.200

The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in...
Keywords: Anti-ZFP91, Anti-FKSG11, Anti-ZNF757, Anti-Zfp-91, EC=6.3.2.-, Anti-Zinc finger protein 757, Anti-Zinc finger protein 91...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
767.00€ *
Review
ZFP91 PrEST Antigen
ZFP91 PrEST Antigen

Item number: ATA-APrEST73788.100

Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or...
Keywords: ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein...
Application: Control antigen
Expressed in: E.coli
Origin: human
265.00€ *
Review
1 from 2 pages