10 products were found matching "GeneID 79713"!
No results were found for the filter!
IGF-like family receptor 1 (IGFLR1), partial (Active),...
Item number: CSB-MP862025HU.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Application: | Active protein |
| Expressed in: | Mammalian cells |
| Origin: | human |
| MW: | 17.4 kD |
From 142.00€
*
IGF-like family receptor 1 (IGFLR1), partial (Active),...
Item number: CSB-MP862025HUd9.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal hFc-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Application: | Active protein |
| Expressed in: | Mammalian cells |
| Origin: | human |
| MW: | 44.1 kD |
From 142.00€
*
IGFLR1 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01515-100ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Keywords: | IGFLR1, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, IGF-like family receptor 1 |
| MW: | 17.4 kD |
From 120.00€
*
IGFLR1 Protein, Human, Recombinant (hFc)
Item number: TGM-TMPY-04160-100ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Keywords: | IGFLR1, IGF-like family receptor 1, U2AF1L4, TMEM149 |
| MW: | 41.4 kD |
768.00€
*
Anti-IGFLR1
Item number: ATA-HPA070778.100
Polyclonal Antibody against Human IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Validated applications: ICC, Uniprot ID: Q9H665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Probable cell...
| Keywords: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
IGFLR1 Protein, Human, Recombinant (His)
Item number: TGM-TMPH-01515-10ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Keywords: | IGFLR1 , TMEM149 , U2AF1L4 , Transmembrane protein 149 , IGF-like family receptor 1 , U2 small nuclear RNA auxiliary... |
| MW: | 17.4 kD |
From 48.00€
*
NEW
IGFLR1 Protein, Human, Recombinant (hFc)
Item number: TGM-TMPY-04160-10ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Keywords: | IGFLR1 , IGF-like family receptor 1 , U2AF1L4 , TMEM149 |
| MW: | 41.4 kD |
From 75.00€
*
TMEM149, Human transmembrane protein 149, Real Time PCR...
Item number: VHPS-9355
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Application: | RNA quantification |
45.00€
*
Anti-IGFR1
Item number: ELK-ES15510.100
Protein function: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell membrane , Single-pass type I membrane protein .
| Keywords: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
IGFLR1 PrEST Antigen
Item number: ATA-APrEST96115.100
PrEST Antigen IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Antigen sequence: LEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Probable cell membrane...
| Keywords: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*