- Search results for GeneID 79137
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
7 products were found matching "GeneID 79137"!
Close filters
Filter by:
No results were found for the filter!
Item number: A305-800A-T
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 165.00€
*
Item number: A305-801A
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | WB, IP |
| Host: | Rabbit |
| Species reactivity: | human |
From 165.00€
*
Item number: ATA-HPA011170.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 80%
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Item number: ATA-HPA075910.100
Polyclonal Antibody against Human RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Validated applications: IHC, Uniprot ID: Q8NC44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene...
| Keywords: | Anti-C2orf17, Anti-Reticulophagy regulator 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: VHPS-3145
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | C2orf17, FAM134A, Protein FAM134A |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST72046.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | C2orf17, Reticulophagy regulator 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-APrEST95680.100
PrEST Antigen RETREG2, Gene description: reticulophagy regulator family member 2, Alternative Gene Names: C2orf17, FAM134A, MAG-2, MGC3035, Antigen sequence: LIQRMYTRLEPLLMQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 94% Rat...
| Keywords: | C2orf17, Reticulophagy regulator 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*