- Search results for GeneID 7862
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "GeneID 7862"!
Close filters
Filter by:
No results were found for the filter!
Item number: BPS-31112
Human Bromodomain and PHD finger containing 1, or BRPF1, amino-acids 627 ? 746 (GenBank Accession No. NM_001003694) with N-terminal HIS-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
| Keywords: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, |
| Application: | BRD binding assays, inhibitor screening, selectivity profiling |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 14.3 kD |
461.00€
*
Item number: ATA-HPA003359.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Application: | IHC, ChIP |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ABS-PP-5851-L.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Peregrin, Bromodomain and PHD finger-containing protein 1, Protein Br140, Recombinant Human BRPF1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 20.5 kD |
From 115.00€
*
Item number: B2852-48.50
The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two...
| Keywords: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Application: | ELISA, FC, IP, WB |
| Host: | Mouse |
| Species reactivity: | human, mouse |
557.00€
*
Item number: 298382.100
Source:, Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL, SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF,...
| Keywords: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
| MW: | 15,1 |
960.00€
*
Item number: ATA-APrEST84803.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB17012.20
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1 |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Item number: ELK-ES18906.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: ABS-PP-5851.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
| Keywords: | Peregrin, Bromodomain and PHD finger-containing protein 1, Protein Br140, Recombinant Human BRPF1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 20.5 kD |
From 90.00€
*