5 products were found matching "GeneID 728591"!
No results were found for the filter!
Anti-CCDC169
Item number: ATA-HPA040527.100
Polyclonal Antibody against Human CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Validated applications: ICC, Uniprot ID: A6NNP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
| Keywords: | Anti-CCDC169, Anti-C13orf38, Anti-Coiled-coil domain-containing protein 169 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
CCDC169 (human), recombinant protein
Item number: ABS-PP-9656-L.100
| Keywords: | Coiled-coil domain-containing protein 169, Recombinant Human CCDC169 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 115.00€
*
C13orf38, Human chromosome 13 open reading frame 38, Real...
Item number: VHPS-1008
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | C13orf38, UPF0594 protein C13orf38 |
| Application: | RNA quantification |
45.00€
*
CCDC169 (human), recombinant protein
Item number: ABS-PP-9656.100
| Keywords: | Coiled-coil domain-containing protein 169, Recombinant Human CCDC169 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 90.00€
*
CCDC169 PrEST Antigen
Item number: ATA-APrEST95859.100
PrEST Antigen CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Antigen sequence: VKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 33% Rat...
| Keywords: | CCDC169, C13orf38, Coiled-coil domain-containing protein 169 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
