7 products were found matching "GeneID 728361"!
No results were found for the filter!
Putative transcription factor ovo-like protein 3 (OVOL3),...
Item number: CSB-EP522313HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-214aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: MPRAFLVRSR RPQPPNWGHL PDQLRGDAYI PGGPLTVPGG KGQERRSVTI WLFSSDCSSL GGPPAQQSSS VRDPWTAQPT QGNLTSAPRG PGTLGCPLCP KAFPLQRMLT...
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3, Recombinant Human Putative transcription factor ovo-like protein... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.3 kD |
From 364.00€
*
OVOL3 Protein, Human, Recombinant (His & Myc)
Item number: TGM-TMPH-01989-100ug
Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3 |
| MW: | 31.3 kD |
From 340.00€
*
Anti-OVOL3
Item number: ATA-HPA047540.100
Polyclonal Antibody against Human OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Validated applications: ICC, Uniprot ID: O00110, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May act as a transcription regulator. [The...
| Keywords: | Anti-OVOL3, Anti-Putative transcription factor ovo-like protein 3 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
OVOL3 Protein, Human, Recombinant (His & Myc)
Item number: TGM-TMPH-01989-10ug
Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
| Keywords: | OVOL3 , Putative transcription factor ovo-like protein 3 |
| MW: | 31.3 kD |
From 122.00€
*
OVOL3 (human), recombinant protein
Item number: ABS-PP-1902-L.100
Protein function: May act as a transcription regulator. [The UniProt Consortium]
| Keywords: | Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
OVOL3 (human), recombinant protein
Item number: ABS-PP-1902.100
Protein function: May act as a transcription regulator. [The UniProt Consortium]
| Keywords: | Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 90.00€
*
OVOL3 PrEST Antigen
Item number: ATA-APrEST96013.100
PrEST Antigen OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Antigen sequence: CSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May act as a transcription regulator. [The UniProt Consortium]...
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*