- Search results for GeneID 728361
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "GeneID 728361"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-EP522313HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-214aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: MPRAFLVRSR RPQPPNWGHL PDQLRGDAYI PGGPLTVPGG KGQERRSVTI WLFSSDCSSL GGPPAQQSSS VRDPWTAQPT QGNLTSAPRG PGTLGCPLCP KAFPLQRMLT...
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3, Recombinant Human Putative transcription factor ovo-like protein... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.3 kD |
From 364.00€
*
Item number: TGM-TMPH-01989-100ug
Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3 |
| MW: | 31.3 kD |
From 340.00€
*
Item number: ATA-HPA047540.100
Polyclonal Antibody against Human OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Validated applications: ICC, Uniprot ID: O00110, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May act as a transcription regulator. [The...
| Keywords: | Anti-OVOL3, Anti-Putative transcription factor ovo-like protein 3 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA047540.25
Polyclonal Antibody against Human OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Validated applications: ICC, Uniprot ID: O00110, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May act as a transcription regulator. [The...
| Keywords: | Anti-OVOL3, Anti-Putative transcription factor ovo-like protein 3 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: TGM-TMPH-01989-10ug
Description: OVOL3 Protein, Human, Recombinant (His & Myc) is expressed in E. coli.
| Keywords: | OVOL3 , Putative transcription factor ovo-like protein 3 |
| MW: | 31.3 kD |
From 122.00€
*
Item number: ABS-PP-1902.100
Protein function: May act as a transcription regulator. [The UniProt Consortium]
| Keywords: | Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 90.00€
*
Item number: ATA-APrEST96013.100
PrEST Antigen OVOL3, Gene description: ovo like zinc finger 3, Alternative Gene Names: HOVO3, Antigen sequence: CSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May act as a transcription regulator. [The UniProt Consortium]...
| Keywords: | OVOL3, Putative transcription factor ovo-like protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-1902-L.100
Protein function: May act as a transcription regulator. [The UniProt Consortium]
| Keywords: | Putative transcription factor ovo-like protein 3, Recombinant Human OVOL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*