- Search results for GeneID 72373
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
14 products were found matching "GeneID 72373"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-YP018840MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-95aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LQCYSCTAQM NNRDCLNVQN CSLDQHSCFT SRIRAIGLVT VISKGCSSQC EDDSENYYLG KKNITCCYSD LCNVN. Purity: Greater than 90% as determined by SDS-PAGE....
| Keywords: | Psca, Prostate stem cell antigen, Recombinant Mouse Prostate stem cell antigen (Psca) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 10.4 kD |
From 292.00€
*
Item number: DIM-PME-M100045.10
Recombinant mouse PSCA protein with C-terminal human Fc tag. Mouse PSCA(Leu21-Asn95) hFc(Glu99-Ala330), Protein function: May be involved in the regulation of cell proliferation. [The UniProt Consortium]
| Keywords: | UNQ206, PRO232 |
| Expressed in: | Human cells |
| Origin: | mouse |
| MW: | 34.5 kD |
From 151.00€
*
Item number: TGM-TMPK-00906-100ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Keywords: | PSCA, UNQ206, PRO232 |
| MW: | 34.5 kD |
From 460.00€
*
Item number: TGM-TMPY-06655-100ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Keywords: | 2210408B04Rik, prostate stem cell antigen |
| MW: | 11.64 kD |
From 568.00€
*
Item number: TGM-TMPY-06710-100ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.83 kDa and the accession number is P57096.
| Keywords: | prostate stem cell antigen, 2210408B04Rik |
| MW: | 9.83 kD |
From 658.00€
*
Item number: GSC-Z06323-100
Prosaposin (also known as SGP-1) is an intriguing multifunctional protein that plays roles both intracellularly, as a regulator of lysosomal enzyme function, and extracellularly, as a secreted factor with neuroprotective and glioprotective effects.
| Keywords: | Psca, Prostate stem cell antigen |
| Origin: | mouse |
| MW: | 60.86 kD |
From 524.00€
*
Item number: GSC-Z06325-100
Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers. Existing studies...
| Keywords: | Psca, Prostate stem cell antigen |
| Origin: | mouse |
| MW: | 34.5 kD |
From 524.00€
*
Item number: TGM-TMPK-00906-10ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Keywords: | UNQ206 , PSCA , PRO232 |
| MW: | 34.5 kD |
From 55.00€
*
Item number: TGM-TMPY-06655-10ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Keywords: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 11.64 kD |
From 202.00€
*
Item number: TGM-TMPY-06710-10ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.8 kDa and the accession number is P57096.
| Keywords: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 9.8 kD |
From 65.00€
*
Item number: VMPS-5109
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Psca, mCG_2793, Prostate stem cell antigen |
| Application: | RNA quantification |
45.00€
*
Item number: 374902.100
May be involved in the regulation of cell proliferation. Source: Recombinant protein corresponding to aa21-95 from mouse PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.4kD, AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN, Storage and...
| Keywords: | Psca, Prostate stem cell antigen |
| MW: | 10,4 |
From 636.00€
*