- Search results for GeneID 6534
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
14 products were found matching "GeneID 6534"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA063773.100
Polyclonal Antibody against Human SLC6A7, Gene description: solute carrier family 6 member 7, Alternative Gene Names: PROT, Validated applications: ICC, Uniprot ID: Q99884, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Terminates the action of proline by...
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter |
Application: | ICC |
Host: | Rabbit |
Species reactivity: | human |
477.00€
*
Item number: CSB-PA04209A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA211832.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, rat |
From 167.00€
*
Item number: CSB-PA577390.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Application: | ELISA, IHC |
Host: | Rabbit |
Species reactivity: | human, rat |
From 167.00€
*
Item number: E-AB-16846.120
This gene is a member of the gamma-aminobutyric acid (GABA) neurotransmitter gene family and encodes a high-affinity mammalian brain L-proline transporter protein. This transporter protein differs from other sodium-dependent plasma membrane carriers by its pharmacological specificity, kinetic properties, and ionic...
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, SLC6A7... |
Application: | IHC, ELISA |
Host: | Rabbit |
Species reactivity: | human, rat |
From 89.00€
*
Item number: ATA-HPA028907.100
Protein function: Terminates the action of proline by its high affinity sodium- dependent reuptake into presynaptic terminals. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 88% and to rat: 89%
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter |
Application: | IHC |
Host: | Rabbit |
Species reactivity: | human |
From 239.00€
*

Item number: ATA-APrEST96102.100
PrEST Antigen SLC6A7, Gene description: solute carrier family 6 member 7, Alternative Gene Names: PROT, Antigen sequence: REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Terminates the action of...
Keywords: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
Expressed in: | E.coli |
Origin: | human |
265.00€
*

Item number: CSB-CL858729HU.10
Length: 1911 Sequence: ATGAAGAAGC TCCAGGGAGC TCACCTCCGC AAGCCTGTCA CCCCAGACCT GCTGATGACC CCCAGTGACC AGGGCGATGT CGACCTGGAT GTGGACTTTG CTGCACACCG GGGGAACTGG ACAGGCAAGC TGGACTTCCT GCTGTCCTGC ATTGGCTACT GTGTAGGCCT GGGGAATGTC TGGCGCTTCC CCTATCGAGC GTACACCAAT GGAGGAGGCG CCTTCCTCGT GCCCTACTTC CTCATGCTGG CCATCTGTGG...
Keywords: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
Application: | Molecular biology, clone |
Species reactivity: | human |
357.00€
*

Item number: CSB-PA04209B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA04209C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: CSB-PA04209D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: SLC6A7. Antigen Species: Human
Keywords: | Anti-PROT, Anti-SLC6A7, Anti-Solute carrier family 6 member 7, Anti-Sodium-dependent proline transporter, solute carrier... |
Application: | ELISA |
Host: | Rabbit |
Species reactivity: | human |
From 167.00€
*

Item number: VHPS-8599
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: | PROT, SLC6A7, Solute carrier family 6 member 7, Sodium-dependent proline transporter |
Application: | RNA quantification |
44.00€
*