- Search results for GeneID 653140
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "GeneID 653140"!
Close filters
Filter by:
No results were found for the filter!
Item number: ABS-KC-3163.100
| Keywords: | Anti-Protein FAM228A, FAM228A Antibody |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ATA-HPA075817.100
Polyclonal Antibody against Human FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Validated applications: ICC, Uniprot ID: Q86W67, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat...
| Keywords: | Anti-FAM228A, Anti-C2orf84, Anti-Protein FAM228A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-9848-L.100
| Keywords: | Protein FAM228A, Recombinant Human FAM228A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
Item number: ABS-OC-447.100
| Keywords: | Anti-Protein FAM228A, FAM228A Antibody |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human, rat |
From 206.00€
*
Item number: ABS-PP-9848.100
| Keywords: | Protein FAM228A, Recombinant Human FAM228A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 90.00€
*
Item number: ATA-APrEST96157.100
PrEST Antigen FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Antigen sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | FAM228A, C2orf84, Protein FAM228A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*