11 products were found matching "GeneID 64921"!
No results were found for the filter!
Anti-CASD1
Item number: ATA-HPA044404.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
CAS1 domain-containing protein 1 (CASD1), partial, human,...
Item number: CSB-EP846683HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 39-313aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: ASRRYRGNDS CEYLLSSGRF LGEKVWQPHS CMMHKYKISE AKNCLVDKHI AFIGDSRIRQ LFYSFVKIIN PQFKEEGNKH ENIPFEDKTA SVKVDFLWHP EVNGSMKQCI KVWTEDSIAK PHVIVAGAAT...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 47.2 kD |
From 219.00€
*
Anti-CASD1
Item number: ATA-HPA052908.100
Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
CASD1 (human), recombinant protein
Item number: ABS-PP-3125-L.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 115.00€
*
Anti-CASD1, NT (CAS1 Domain-containing Protein 1,...
Item number: C2084-10-APC.200
Applications: , Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Keywords: | Anti-CASD1, Anti-C7orf12, Anti-Nbla04196, Anti-CAS1 domain-containing protein 1 |
| Application: | FLISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
1,104.00€
*
Anti-CASD1, NT (CAS1 Domain-containing Protein 1,...
Item number: C2084-10.200
Applications: , Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Keywords: | Anti-CAS1 domain-containing protein 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
CASD1, Recombinant, Human, aa39-313, His-SUMO-Tag (CAS1...
Item number: 372576.100
Source:, Recombinant protein corresponding to aa39-313 from human CASD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD, AA Sequence:...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| MW: | 47,2 |
From 603.00€
*
CASD1 PrEST Antigen
Item number: ATA-APrEST74963.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CASD1 (human), recombinant protein
Item number: ABS-PP-3125.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Keywords: | N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 17.5 kD |
From 90.00€
*
CASD1 PrEST Antigen
Item number: ATA-APrEST95904.100
PrEST Antigen CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Antigen sequence: LNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDGSCCQPRPPVTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-CASD1
Item number: CSB-PA846683ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
From 1,529.00€
*