6 products were found matching "GeneID 646799"!
No results were found for the filter!
Anti-ZAR1L
Item number: ATA-HPA041319.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
| Keywords: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-ZAR1L
Item number: ATA-HPA039540.100
Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
| Keywords: | Anti-ZAR1L, Anti-ZAR1-like protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ZAR1L (human), recombinant protein
Item number: ABS-PP-9500-L.100
| Keywords: | Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 115.00€
*
ZAR1L PrEST Antigen
Item number: ATA-APrEST81392.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ZAR1L, ZAR1-like protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ZAR1L (human), recombinant protein
Item number: ABS-PP-9500.100
| Keywords: | Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 16 kD |
From 90.00€
*
ZAR1L PrEST Antigen
Item number: ATA-APrEST95928.100
PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
| Keywords: | ZAR1L, ZAR1-like protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*