- Search results for GeneID 64673
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
4 products were found matching "GeneID 64673"!
Close filters
Filter by:
No results were found for the filter!
Item number: ELK-ELK7995.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat PIP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat PIP. Next, Avidin...
| Keywords: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| Application: | ELISA |
| Species reactivity: | rat |
From 374.00€
*
Item number: CSB-YP530344RA.1
Organism: Rattus norvegicus (Rat). Source: Yeast. Expression Region: 27-146aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: QDNETIPQPL LFQLNVPSTP DENQEVDMSL TLQTQYKECL VVKAYLISNT PVDGGFNYIQ TRCICNDHPT TLYWTFVVTQ TLTFRIMVDI VKDKGICPNN VAVVPISGNR...
| Keywords: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog, Recombinant Rat Prolactin-inducible protein homolog... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | rat |
| MW: | 15.7 kD |
From 292.00€
*
Item number: VRPS-4531
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| Application: | RNA quantification |
54.00€
*
Item number: 374868.100
Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN,...
| Keywords: | Pip, Prolactin-induced protein, Prolactin-inducible protein homolog |
| MW: | 15,7 |
From 636.00€
*
