4 products were found matching "GeneID 64673"!

No results were found for the filter!
Rat PIP (Prolactin Induced Protein) ELISA Kit
Rat PIP (Prolactin Induced Protein) ELISA Kit

Item number: ELK-ELK7995.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat PIP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat PIP. Next, Avidin...
Keywords: Pip, Prolactin-induced protein, Prolactin-inducible protein homolog
Application: ELISA
Species reactivity: rat
From 374.00€ *
Review
Prolactin-inducible protein homolog (Pip), rat, recombinant
Prolactin-inducible protein homolog (Pip), rat, recombinant

Item number: CSB-YP530344RA.1

Organism: Rattus norvegicus (Rat). Source: Yeast. Expression Region: 27-146aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: QDNETIPQPL LFQLNVPSTP DENQEVDMSL TLQTQYKECL VVKAYLISNT PVDGGFNYIQ TRCICNDHPT TLYWTFVVTQ TLTFRIMVDI VKDKGICPNN VAVVPISGNR...
Keywords: Pip, Prolactin-induced protein, Prolactin-inducible protein homolog, Recombinant Rat Prolactin-inducible protein homolog...
Application: Activity not tested
Expressed in: Yeast
Origin: rat
MW: 15.7 kD
From 292.00€ *
Review
Pip, Rat prolactin induced protein, Real Time PCR Primer Set
Pip, Rat prolactin induced protein, Real Time PCR Primer Set

Item number: VRPS-4531

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Pip, Prolactin-induced protein, Prolactin-inducible protein homolog
Application: RNA quantification
54.00€ *
Review
Prolactin-inducible Protein Homolog, Recombinant, Rat, aa27-146, His-Tag (PIP)
Prolactin-inducible Protein Homolog, Recombinant, Rat,...

Item number: 374868.100

Source:, Recombinant protein corresponding to aa27-146 from rat Prolactin-inducible Protein Homolog, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.7kD, AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN,...
Keywords: Pip, Prolactin-induced protein, Prolactin-inducible protein homolog
MW: 15,7
From 636.00€ *
Review