- Search results for GeneID 6232
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
15 products were found matching "GeneID 6232"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG63311.100
| Keywords: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
871.00€
*
Item number: NSJ-R35054-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody |
| Application: | WB, ELISA (peptide), IHC (paraffin) |
| Host: | Goat |
| Species reactivity: | human |
836.00€
*
Item number: CSB-PA346286.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: CSB-PA445027.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 167.00€
*
Item number: 375142.100
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| MW: | 36,3 |
From 690.00€
*
Item number: ABS-PP-10806-L.100
Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
| Keywords: | Small ribosomal subunit protein eS27, 40S ribosomal protein S27, Metallopan-stimulin 1, MPS-1, Recombinant Human RPS27... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 10.5 kD |
From 115.00€
*
Item number: 030453.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA, IHC |
| Host: | Mouse |
| Species reactivity: | human |
754.00€
*
Item number: 030454.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Application: | ELISA |
| Host: | Mouse |
| Species reactivity: | human |
754.00€
*
Item number: NSJ-R32561
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 40S ribosomal protein S27, also known as Metallopan-stimulin 1 or MPS-1, is a protein that in humans is encoded by the RPS27 gene. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these...
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | WB, IHC (paraffin), IF, ICC, FC |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
790.00€
*
Item number: G-CAB6729.20
Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
| Keywords: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat |
103.00€
*
Item number: CSB-CL020419HU.10
Length: 255 Sequence: atgcctctcg caaaggatct ccttcatccc tctccagaag aggagaagag gaaacacaag aagaaacgcc tggtgcagag ccccaattcc tacttcatgg atgtgaaatg cccaggatgc tataaaatca ccacggtctt tagccatgca caaacggtag ttttgtgtgt tggctgctcc actgtcctct gccagcctac aggaggaaaa gcaaggctta cagaaggatg ttccttcagg aggaagcagc Protein function:...
| Keywords: | MPS1, RPS27, MPS-1, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA020419ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: RPS27. Antigen Species: Human
| Keywords: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*