- Search results for GeneID 6166
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
17 products were found matching "GeneID 6166"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG40081.100
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
Item number: CSB-RP018044h.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 39.5 kD |
From 219.00€
*
Item number: CSB-PA01804A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA01805A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: E-AB-64989.120
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 243.00€
*
Item number: 375106.1
Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
| Keywords: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| MW: | 39,5 |
From 603.00€
*
Item number: G-CAB14366.100
WB 1:500 - 1:2000.
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL Polyclonal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 103.00€
*
Item number: ELK-ES9327.100
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Keywords: | Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: CSB-PA01804B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA01804C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA01804D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA01805B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Keywords: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*