12 products were found matching "GeneID 60386"!

No results were found for the filter!
SLC25A19 Protein, Human, Recombinant (His)
SLC25A19 Protein, Human, Recombinant (His)

Item number: TGM-TMPH-02333-10ug

Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
Keywords: Mitochondrial thiamine pyrophosphate transporter (MTPPT) , Mitochondrial thiamine pyrophosphate carrier , SLC25A19 , DNC ,...
MW: 37 kD
From 510.00€ *
Review
Mitochondrial thiamine pyrophosphate carrier (SLC25A19), human, recombinant
Mitochondrial thiamine pyrophosphate carrier (SLC25A19),...

Item number: CSB-CF864025HU.100

Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-320aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MVGYDPKPDG RNNTKFQVAV AGSVSGLVTR ALISPFDVIK IRFQLQHERL SRSDPSAKYH GILQASRQIL QEEGPTAFWK GHVPAQILSI GYGAVQFLSF EMLTELVHRG...
Keywords: DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine...
Application: Activity not tested
Expressed in: E.coli in vitro
Origin: human
MW: 37.0 kD
From 1,458.00€ *
Review
SLC25A19 Protein, Human, Recombinant (His)
SLC25A19 Protein, Human, Recombinant (His)

Item number: TGM-TMPH-02333-100ug

Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
Keywords: SLC25A19, Solute carrier family 25 member 19, Mitochondrial thiamine pyrophosphate transporter, Mitochondrial uncoupling...
MW: 37.0 kD
From 1,450.00€ *
Review
Anti-SLC25A19
Anti-SLC25A19

Item number: ATA-HPA021936.100

Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-SLC25A19
Anti-SLC25A19

Item number: E-AB-65956.120

This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,...
Application: IF
Host: Rabbit
Species reactivity: human, mouse
From 243.00€ *
Review
Anti-SLC25A19
Anti-SLC25A19

Item number: ATA-HPA021936.25

Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
SLC25A19, Human solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19,
SLC25A19, Human solute carrier family 25 (mitochondrial...

Item number: VHPS-8494

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: DNC, SLC25A19, Solute carrier family 25 member 19, Mitochondrial uncoupling protein 1, Mitochondrial thiamine...
Application: RNA quantification
45.00€ *
Review
Anti-SLC25A19, CT (SLC25A19, DNC, MUP1, Mitochondrial thiamine pyrophosphate carrier, Mitochondrial
Anti-SLC25A19, CT (SLC25A19, DNC, MUP1, Mitochondrial...

Item number: 041852.200

SLC25A19 encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
865.00€ *
Review
Anti-SLC25A19
Anti-SLC25A19

Item number: NSJ-RQ6117

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial thiamine pyrophosphate carrier is a protein that in humans is encoded by the SLC25A19 gene. This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial...
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,...
Application: WB
Host: Rabbit
Species reactivity: human
790.00€ *
Review
Anti-SLC25A19
Anti-SLC25A19

Item number: G-CAB12373.100

WB 1:500 - 1:2000, IF 1:50 - 1:200. Protein function: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. [The UniProt Consortium]
Keywords: Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,...
Application: WB, IF
Host: Rabbit
Species reactivity: human, mouse, rat
From 103.00€ *
Review
Anti-TPC
Anti-TPC

Item number: ELK-ES18865.100

Protein function: Mitochondrial transporter mediating uptake of thiamine diphosphate into mitochondria. It is not clear if the antiporter activity is affected by the membrane potential or by the proton electrochemical gradient. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:...
Keywords: Anti-MTPPT, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial thiamine...
Application: WB
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
SLC25A19 PrEST Antigen
SLC25A19 PrEST Antigen

Item number: ATA-APrEST96009.100

PrEST Antigen SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Antigen sequence: PKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine...
Expressed in: E.coli
Origin: human
264.00€ *
Review