12 products were found matching "GeneID 59336"!
No results were found for the filter!
Anti-PRDM13
Item number: G-PACO53566.50
PRDM13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, WB applications. PRDM13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
313.00€
*
Anti-PRDM13
Item number: ATA-HPA069705.100
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-PRDM13
Item number: ATA-HPA062648.100
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-PRDM13
Item number: ATA-HPA069705.25
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Anti-PRDM13
Item number: ATA-HPA062648.25
Polyclonal Antibody against Human PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Validated applications: ICC, Uniprot ID: Q9H4Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The...
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Anti-PRDM13, FITC conjugated
Item number: CSB-PA887981LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-PRDM13
Item number: CSB-PA887981LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*
Anti-PRDM13, Biotin conjugated
Item number: CSB-PA887981LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-PRDM13, HRP conjugated
Item number: CSB-PA887981LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: PRDM13. Antigen Species: Human
| Keywords: | Anti-PFM10, Anti-PRDM13, EC=2.1.1.-, Anti-PR domain-containing protein 13, Anti-PR domain zinc finger protein 13, PRDM13... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
PRDM13 (human), recombinant protein
Item number: ABS-PP-10331.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 90.00€
*
PRDM13 PrEST Antigen
Item number: ATA-APrEST96061.100
PrEST Antigen PRDM13, Gene description: PR/SET domain 13, Alternative Gene Names: PFM10, Antigen sequence: PLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional...
| Keywords: | PFM10, PRDM13, EC=2.1.1.-, PR domain-containing protein 13, PR domain zinc finger protein 13 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PRDM13 (human), recombinant protein
Item number: ABS-PP-10331-L.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Keywords: | PR domain zinc finger protein 13, PR domain-containing protein 13, Recombinant Human PRDM13 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 115.00€
*