8 products were found matching "GeneID 58508"!

No results were found for the filter!
MLL3 Complex Chemiluminescent Assay Kit
MLL3 Complex Chemiluminescent Assay Kit

Item number: BPS-79758

The MLL3 Complex Chemiluminescent Assay Kit is designed to measure MLL3 activity for screening and profiling applications, using purified MLL3 and its complex components: WDR5, RbBP5, Ash2, and DPY30. The key to the MLL3 Complex Chemiluminescent Assay Kit is a highly specific antibody that recognizes methylated K4...
Keywords: KMT2C, HALR, MLL3, lysine methyltransferase 2C, KLEFS2,
Application: Enzyme kinetics, HTS
Species reactivity: human
1,182.00€ *
Review
Anti-KMT2C
Anti-KMT2C

Item number: ATA-HPA074736.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Keywords: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Application: ICC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-KMT2C
Anti-KMT2C

Item number: ATA-HPA062814.100

Polyclonal Antibody against Human KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Validated applications: ICC, WB, Uniprot ID: Q8NEZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Histone...
Keywords: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Application: WB, ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-MLL3 / KMT2C, clone 1686CT202.60.69
Anti-MLL3 / KMT2C, clone 1686CT202.60.69

Item number: NSJ-F55128-0.05ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. KMT2C (Lysine N-methyltransferase 2C), also called MML3 (Myeloid/lymphoid or mixed-lineage leukemia protein 3) is a histone methyltransferase, which means it adds methyl groups to histone proteins. This modification plays a critical role in controlling how genes are turned...
Keywords: Anti-HALR, Anti-KMT2C, Anti-Homologous to ALR protein, Anti-Lysine N-methyltransferase 2C, Anti-Histone-lysine...
Application: WB
Host: Rabbit
Species reactivity: human
From 361.00€ *
Review
KMT2C (human), recombinant protein
KMT2C (human), recombinant protein

Item number: ABS-PP-914-L.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Keywords: Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or...
Expressed in: E.coli
Origin: human
MW: 31 kD
From 115.00€ *
Review
KMT2C PrEST Antigen
KMT2C PrEST Antigen

Item number: ATA-APrEST93244.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Keywords: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
KMT2C (human), recombinant protein
KMT2C (human), recombinant protein

Item number: ABS-PP-914.100

Protein function: Histone methyltransferase that methylates 'Lys-4' of histone H3 (PubMed:22266653). H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional...
Keywords: Histone-lysine N-methyltransferase 2C, Lysine N-methyltransferase 2C, Homologous to ALR protein, Myeloid/lymphoid or...
Expressed in: E.coli
Origin: human
MW: 31 kD
From 90.00€ *
Review
KMT2C PrEST Antigen
KMT2C PrEST Antigen

Item number: ATA-APrEST95694.100

PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,...
Expressed in: E.coli
Origin: human
264.00€ *
Review