11 products were found matching "GeneID 57488"!
No results were found for the filter!
Anti-ESYT2
Item number: ATA-HPA002132.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Keywords: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Extended synaptotagmin-2 (ESYT2), partial, human,...
Item number: CSB-EP008279HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 191-662aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: DTERAEWLNK TVKHMWPFIC QFIEKLFRET IEPAVRGANT HLSTFSFTKV DVGQQPLRIN GVKVYTENVD KRQIILDLQI SFVGNCEIDL EIKRYFCRAG VKSIQIHGTM...
| Keywords: | E-Syt2, FAM62B, Chr2Syt, Extended synaptotagmin-2, Recombinant Human Extended synaptotagmin-2 (ESYT2), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 61.4 kD |
From 292.00€
*
Anti-ESYT2
Item number: ATA-HPA070823.100
Polyclonal Antibody against Human ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Validated applications: ICC, Uniprot ID: A0FGR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Tethers the endoplasmic...
| Keywords: | Anti-FAM62B, Anti-E-Syt2, Anti-Chr2Syt, Anti-Extended synaptotagmin-2 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ESYT2 (human), recombinant protein
Item number: ABS-PP-5734-L.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Keywords: | Extended synaptotagmin-2, E-Syt2, Chr2Syt, Recombinant Human ESYT2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26.5 kD |
From 115.00€
*
ESYT2 PrEST Antigen
Item number: ATA-APrEST85126.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Keywords: | E-Syt2, FAM62B, Chr2Syt, Extended synaptotagmin-2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-ESYT2
Item number: CSB-PA008279LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Keywords: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ESYT2, FITC conjugated
Item number: CSB-PA008279LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Keywords: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ESYT2, Biotin conjugated
Item number: CSB-PA008279LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Keywords: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-ESYT2, HRP conjugated
Item number: CSB-PA008279LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Keywords: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
ESYT2 (human), recombinant protein
Item number: ABS-PP-5734.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Keywords: | Extended synaptotagmin-2, E-Syt2, Chr2Syt, Recombinant Human ESYT2 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26.5 kD |
From 90.00€
*
ESYT2 PrEST Antigen
Item number: ATA-APrEST95755.100
PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Antigen sequence: DHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDQGRSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Tethers the...
| Keywords: | FAM62B, E-Syt2, Chr2Syt, Extended synaptotagmin-2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*