10 products were found matching "GeneID 574243"!

No results were found for the filter!
C-X-C motif chemokine 10 protein (CXCL10) (Active), Macaca mulatta, recombinant
C-X-C motif chemokine 10 protein (CXCL10) (Active),...

Item number: CSB-AP001031MOW.100

Organism: Macaca mulatta (Rhesus macaque). Source: E.Coli. Expression Region: 22-98aa. Protein Length: Full Length of Mature Protein. Tag Info: Tag-Free. Target Protein Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP. Purity: >97% as determined by SDS-PAGE. Endotoxin:...
Keywords: IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced...
Application: Active protein
Origin: Rhesus macaque
MW: 8.7 kD
From 171.00€ *
Review
C-X-C motif chemokine 10 (CXCL10), Macaca mulatta, recombinant
C-X-C motif chemokine 10 (CXCL10), Macaca mulatta,...

Item number: CSB-EP822646MOW.1

Organism: Macaca mulatta (Rhesus macaque). Source: E.coli. Expression Region: 22-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP. Purity: Greater than 90% as...
Keywords: IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced...
Application: Activity not tested
Expressed in: E.coli
Origin: Rhesus macaque
MW: 12.7 kD
From 364.00€ *
Review
Monkey C-X-C motif chemokine 10 (CXCL10) ELISA kit
Monkey C-X-C motif chemokine 10 (CXCL10) ELISA kit

Item number: CSB-EL006240RH.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 62.5 pg/mL-4000 pg/mL Sensitivity: 15.6 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [The...
Keywords: IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced...
Application: ELISA, Sandwich ELISA
Species reactivity: monkey
From 658.00€ *
Review
C-X-C motif chemokine 10, active (CXCL10), Recombinant, Rhesus Macaque
C-X-C motif chemokine 10, active (CXCL10), Recombinant,...

Item number: 347995.5

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 (By similarity). {ECO:0000250}. Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50ng/ml....
Keywords: IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced...
MW: 8,7
412.00€ *
Review
Anti-CXCL10
Anti-CXCL10

Item number: G-PACO38206.50

CXCL10 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Macaca mulatta and for use in ELISA applications. CXCL10 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [The UniProt Consortium]
Keywords: Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,...
Application: ELISA
Host: Rabbit
Species reactivity: Macaca mulatta
313.00€ *
Review
CXCL10, Recombinant, Macaca Mulatta, aa22-98, His-Tag (C-X-C Motif Chemokine 10)
CXCL10, Recombinant, Macaca Mulatta, aa22-98, His-Tag...

Item number: 372922.100

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from macaca mulatta CXCL10, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7kD, AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP,...
Keywords: IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced...
MW: 12,7
From 786.00€ *
Review
Anti-CXCL10
Anti-CXCL10

Item number: CSB-PA822646LA01MOW.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
Keywords: Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,...
Application: ELISA
Host: Rabbit
Species reactivity: Macaca mulatta
From 167.00€ *
Review
Anti-CXCL10, HRP conjugated
Anti-CXCL10, HRP conjugated

Item number: CSB-PA822646LB01MOW.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
Keywords: Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,...
Application: ELISA
Host: Rabbit
Species reactivity: Macaca mulatta
From 167.00€ *
Review
Anti-CXCL10, FITC conjugated
Anti-CXCL10, FITC conjugated

Item number: CSB-PA822646LC01MOW.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
Keywords: Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,...
Host: Rabbit
Species reactivity: Macaca mulatta
From 167.00€ *
Review
Anti-CXCL10, Biotin conjugated
Anti-CXCL10, Biotin conjugated

Item number: CSB-PA822646LD01MOW.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CXCL10. Antigen Species: Macaca mulatta (Rhesus macaque)
Keywords: Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,...
Application: ELISA
Host: Rabbit
Species reactivity: Macaca mulatta
From 167.00€ *
Review