- Search results for GeneID 57147
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
24 products were found matching "GeneID 57147"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA005624.100
Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 53%
| Keywords: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ABS-KC-3762.100
Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt Consortium]
| Keywords: | Anti-Protein-associating with the carboxyl-terminal domain of ezrin, Anti-Ezrin-binding protein PACE-1, Anti-SCY1-like... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ATA-HPA072383.100
Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
| Keywords: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-ES-2106.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Keywords: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ABS-ES-2107.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Keywords: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ABS-ES-2108.1
Product Description: SCY1 like pseudokinase 3 (SCYL3), also known as PACE-1, is a member of the SCYL protein family characterized by an inactive kinase domain, central HEAT repeats, and a disorganized C-terminal segment. Unlike conventional kinases, SCYL3's pseudokinase domain lacks catalytic activity but may play...
| Keywords: | Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | ELISA |
| Host: | Mouse/Mouse |
| Species reactivity: | human |
1,080.00€
*
Item number: ATA-HPA072383.25
Polyclonal Antibody against Human SCYL3, Gene description: SCY1 like pseudokinase 3, Alternative Gene Names: PACE-1, PACE1, Validated applications: ICC, WB, Uniprot ID: Q8IZE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in regulating...
| Keywords: | Anti-PACE1, Anti-SCYL3, Anti-SCY1-like protein 3, Anti-Ezrin-binding protein PACE-1, Anti-Protein-associating with the... |
| Application: | WB, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 009-001-T27S
Recombinant human SCYL3 (2-end) was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >85% by densitometry. Protein function: May play a role in regulating cell adhesion/migration complexes in migrating cells. [The UniProt...
| Keywords: | PACE1, SCYL3, SCY1-like protein 3, Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of... |
| Application: | WB |
| Expressed in: | Human |
497.00€
*
Item number: VHPS-6591
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | PACE1, SCYL3, SCY1-like protein 3, Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of... |
| Application: | RNA quantification |
45.00€
*
Item number: 133050.50
Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | IF, WB |
| Host: | Mouse |
| Species reactivity: | human |
850.00€
*
Item number: 133051.100
Applications:, Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:...
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
943.00€
*
Item number: 133052.100
Applications:, Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS, Storage and...
| Application: | ELISA, WB |
| Host: | Mouse |
| Species reactivity: | human |
850.00€
*