18 products were found matching "GeneID 56986"!
No results were found for the filter!
Anti-DTWD1
Item number: G-PACO26353.50
DTWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. DTWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in...
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-DTWD1
Item number: ATA-HPA042214.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 87%...
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
DTW domain-containing protein 1 (DTWD1), partial, human,...
Item number: CSB-EP007219HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-109aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MSLNPPIFLK RSEENSSKFV ETKQSQTTSI ASEDPLQNLC LASQEVLQKA QQSGRSKCLK CGGSRMFYCY TCYVPVENVP IEQIPLVKLP LKIDIIKHPN ETDGKSTAI. Purity: Greater than 90% as...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1, Recombinant Human DTW domain-containing... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 39.2 kD |
From 219.00€
*
MDS009, Human, Real Time PCR Primer Set
Item number: VHPS-5634
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | DTWD1, MDS009, DTW domain-containing protein 1 |
| Application: | RNA quantification |
45.00€
*
Anti-DTWD1, ID (DTWD1, DTW domain-containing protein 1)
Item number: 034838.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Keywords: | Anti-DTWD1, Anti-MDS009, Anti-DTW domain-containing protein 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
DTWD1, Recombinant, Human, aa1-109, GST-Tag (DTW...
Item number: 373105.1
Source:, Recombinant protein corresponding to aa1-109 from human DTWD1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD, AA Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI, Storage and Stability: May be stored...
| Keywords: | DTWD1, MDS009, DTW domain-containing protein 1 |
| MW: | 39,2 |
From 603.00€
*
DTWD1 PrEST Antigen
Item number: ATA-APrEST82659.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-DTWD1
Item number: ELK-ES16884.100
Protein function: Catalyzes the formation of 3-(3-amino-3-carboxypropyl)uridine (acp3U) at position 20 in the D-loop of several cytoplasmic tRNAs (acp3U(20)). [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTWD1 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
DTWD1 (Vector pENTR223.1, Accession No. BC032535)
Item number: CSB-CL839801HU1.10
Length: 915 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
DTWD1 (Vector Vector will be determined during the...
Item number: CSB-CL839801HU2.10
Length: 330 Sequence: atgtctctca atccacctat atttctcaaa cgaagtgaag aaaatagttc aaaatttgtg gaaacaaaac agtcacaaac tacttccata gcttcagaag atccccttca aaacttatgt ttagcatctc aagaagttct tcaaaaagct cagcaaagtg ggagatcaaa atgtctcaaa tgtggtggtt ccagaatgtt ctactgctat acatgttatg ttccagttga aaatgtacct attgaacaga ttccacttgt...
| Keywords: | DTW domain-containing protein 1, tRNA-uridine aminocarboxypropyltransferase 1 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-DTWD1
Item number: CSB-PA007219EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-DTWD1, FITC conjugated
Item number: CSB-PA007219EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: DTWD1. Antigen Species: Human
| Keywords: | Anti-DTW domain-containing protein 1, Anti-tRNA-uridine aminocarboxypropyltransferase 1, DTW domain containing 1 antibody,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*