- Search results for GeneID 56673
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "GeneID 56673"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA040644.100
Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | Anti-C11orf16, Anti-Uncharacterized protein C11orf16 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA040644.25
Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | Anti-C11orf16, Anti-Uncharacterized protein C11orf16 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: VHPS-964
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | C11orf16 C11orf16 |
| Application: | RNA quantification |
45.00€
*
Item number: ELK-ES17437.100
Recommended dilutions: WB 1:500-2000. Cellular localization:
| Keywords: | Anti-C11orf16, Anti- C11orf16, CK016 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: CSB-CL865100HU.10
Length: 1215 Sequence: atggaatcct ccacggggcc caggatgcct ttgctcaaat actgcagcgt ggccacaagc ctgaaggccc ctggctggga cggtgctgct ccaccttggg acctctcctt cacctacccc tttgccctcc aagcaccctg gctcaccggg cacaagcccc ttgcaaggca tgcctcttct tgcccatgtc tccacgttgc cgacccagca tggcaggggc ctggctggct gggaagagct ggagatgctg ccaacacatg...
| Keywords: | C11orf16, Uncharacterized protein C11orf16 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: ABS-PP-9985.100
| Keywords: | Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 90.00€
*
Item number: ATA-APrEST95631.100
PrEST Antigen C11orf16, Gene description: chromosome 11 open reading frame 16, Antigen sequence: WRYWKRNGPEPCPGKPGTRYSNICKEEKDHKQQRAQTVVVGTTKELVSKATHMKPPQTPPGEAEHRKRSQSLAICQWN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | C11orf16, Uncharacterized protein C11orf16 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-9985-L.100
| Keywords: | Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 115.00€
*