8 products were found matching "GeneID 56673"!
No results were found for the filter!
Anti-C11orf16
Item number: ATA-HPA040644.100
Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | Anti-C11orf16, Anti-Uncharacterized protein C11orf16 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-C11orf16
Item number: ATA-HPA040644.25
Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | Anti-C11orf16, Anti-Uncharacterized protein C11orf16 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
C11orf16, Human chromosome 11 open reading frame 16, Real...
Item number: VHPS-964
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | C11orf16 C11orf16 |
| Application: | RNA quantification |
45.00€
*
Anti-CK016
Item number: ELK-ES17437.100
Recommended dilutions: WB 1:500-2000. Cellular localization:
| Keywords: | Anti-C11orf16, Anti- C11orf16, CK016 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
C11orf16 (Vector Vector will be determined during the...
Item number: CSB-CL865100HU.10
Length: 1215 Sequence: atggaatcct ccacggggcc caggatgcct ttgctcaaat actgcagcgt ggccacaagc ctgaaggccc ctggctggga cggtgctgct ccaccttggg acctctcctt cacctacccc tttgccctcc aagcaccctg gctcaccggg cacaagcccc ttgcaaggca tgcctcttct tgcccatgtc tccacgttgc cgacccagca tggcaggggc ctggctggct gggaagagct ggagatgctg ccaacacatg...
| Keywords: | C11orf16, Uncharacterized protein C11orf16 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
C11orf16 (human), recombinant protein
Item number: ABS-PP-9985.100
| Keywords: | Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 90.00€
*
C11orf16 PrEST Antigen
Item number: ATA-APrEST95631.100
PrEST Antigen C11orf16, Gene description: chromosome 11 open reading frame 16, Antigen sequence: WRYWKRNGPEPCPGKPGTRYSNICKEEKDHKQQRAQTVVVGTTKELVSKATHMKPPQTPPGEAEHRKRSQSLAICQWN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 27% Rat gene identity: 27%
| Keywords: | C11orf16, Uncharacterized protein C11orf16 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C11orf16 (human), recombinant protein
Item number: ABS-PP-9985-L.100
| Keywords: | Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18 kD |
From 115.00€
*