19 products were found matching "GeneID 5533"!

1 from 2 pages
No results were found for the filter!
Anti-PPP3CC
Anti-PPP3CC

Item number: ATA-HPA074370.100

Polyclonal Antibody against Human PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Validated applications: ICC, Uniprot ID: P48454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Keywords: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Application: ICC
Host: Rabbit
Species reactivity: human
477.00€ *
Review
Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (PPP3CC), partial, human, re
Serine/threonine-protein phosphatase 2B catalytic subunit...

Item number: CSB-EP018574HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-512aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SGRRFHLSTT DRVIKAVPFP PTQRLTFKEV FENGKPKVDV LKNHLVKEGR LEEEVALKII NDGAAILRQE KTMIEVDAPI TVCGDIHGQF FDLMKLFEVG GSPSNTRYLF LGDYVDRGYF SIECVLYLWS LKINHPKTLF...
Keywords: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 62 kD
From 219.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: NSJ-F40087-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Keywords: Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic...
Application: WB, IHC, ELISA
Host: Rabbit
Species reactivity: human
From 350.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: NSJ-F40178-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Keywords: Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic...
Application: IHC, WB, ELISA
Host: Rabbit
Species reactivity: human
From 350.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: ATA-HPA023396.100

Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32....
Keywords: Anti-CALNA3, Anti-PPP3CC, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Application: ICC, IHC, WB
Host: Rabbit
Species reactivity: human
From 239.00€ *
Review
PPP3CC PrEST Antigen
PPP3CC PrEST Antigen

Item number: ATA-APrEST95711.100

PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
Keywords: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Expressed in: E.coli
Origin: human
265.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: CSB-PA018574GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: CSB-PA018574ESR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, rat
From 167.00€ *
Review
Anti-PPP3CC
Anti-PPP3CC

Item number: CSB-PA018574ESR1HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Keywords: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Application: ELISA, WB, IHC
Host: Rabbit
Species reactivity: human, rat
From 167.00€ *
Review
PPP3CC (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
PPP3CC (Vector Vector will be determined during the...

Item number: CSB-CL018574HU.10

Length: 1539 Sequence: atgtccggga ggcgcttcca cctctccacc accgaccgcg tcatcaaagc tgtccccttt cctccaaccc aacggcttac tttcaaggaa gtatttgaga atgggaaacc taaagttgat gttttaaaaa accatttggt aaaggaagga cgactggaag aggaagtagc cttaaagata atcaatgatg gggctgccat cctgaggcaa gagaagacta tgatagaagt agatgctcca atcacagtat gtggtgatat...
Keywords: CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Application: Molecular biology, clone
Species reactivity: human
357.00€ *
Review
PPP3CC, Human protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, Real Time PCR P
PPP3CC, Human protein phosphatase 3 (formerly 2B),...

Item number: VHPS-7178

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CALNA3, PPP3CC, EC=3.1.3.16, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit,...
Application: RNA quantification
44.00€ *
Review
Anti-PPP3CC, NT (PPP3CC, CALNA3, CNA3, Serine/threonine-protein phosphatase 2B catalytic subunit gam
Anti-PPP3CC, NT (PPP3CC, CALNA3, CNA3,...

Item number: 040359.200

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be...
Keywords: Anti-PPP3CC, Anti-CALNA3, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic...
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human
767.00€ *
Review
1 from 2 pages