8 products were found matching "GeneID 55094"!
No results were found for the filter!
Anti-GPATCH1
Item number: ATA-HPA043430.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 85% and to rat: 85%
| Keywords: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-GPATCH1
Item number: ATA-HPA043604.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 88% and to rat: 88%
| Keywords: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 246.00€
*
Anti-GPATCH1
Item number: ATA-HPA074327.100
Polyclonal Antibody against Human GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Validated applications: ICC, Uniprot ID: Q9BRR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 86% Rat...
| Keywords: | Anti-ECGP, Anti-GPATCH1, Anti-G patch domain-containing protein 1, Anti-Evolutionarily conserved G-patch domain-containing... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
GPATCH1 (human), recombinant protein
Item number: ABS-PP-6825-L.100
| Keywords: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19 kD |
From 115.00€
*
GPATCH1 PrEST Antigen
Item number: ATA-APrEST82457.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
GPATCH1 PrEST Antigen
Item number: ATA-APrEST82458.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
GPATCH1 (human), recombinant protein
Item number: ABS-PP-6825.100
| Keywords: | G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein, Recombinant Human GPATCH1... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19 kD |
From 90.00€
*
GPATCH1 PrEST Antigen
Item number: ATA-APrEST95616.100
PrEST Antigen GPATCH1, Gene description: G-patch domain containing 1, Alternative Gene Names: ECGP, FLJ10206, FLJ38686, GPATC1, Antigen sequence: RYVGKILDGFSLASKPLSSKKIYPPPELPRDYRPVHYFRPMVAATSENSHLLQVLSESAGKATPDPGTHSKHQLNASKRAELLGETPIQGSATSVL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | ECGP, GPATCH1, G patch domain-containing protein 1, Evolutionarily conserved G-patch domain-containing protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*