- Search results for GeneID 55028
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "GeneID 55028"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA012626.100
Rabbit Polyclonal C17orf80 Antibody against Human chromosome 17 open reading frame 80. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000041623: 51%,...
| Keywords: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
463.00€
*
Item number: ATA-HPA012896.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 51% and to rat: 52%
| Keywords: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Application: | ICC, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA010974.100
Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated applications: ICC, Uniprot ID: Q9BSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35%...
| Keywords: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA073479.100
Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated applications: ICC, WB, Uniprot ID: Q9BSJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
| Keywords: | Anti-HLC8, Anti-HLC-8, Anti-C17orf80, Anti-Uncharacterized protein C17orf80, Anti-Human lung cancer oncogene 8 protein,... |
| Application: | ICC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-2701-L.100
| Keywords: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15.5 kD |
From 115.00€
*
Item number: ABS-PQ-767-L.100
| Keywords: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 37.5 kD |
From 295.00€
*
Item number: VHPS-1095
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | HLC8, HLC-8, C17orf80 C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing gene 3 protein |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST72009.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-CL863113HU.10
Length: 1830 Sequence: atgagtgata atccacccag aatggaagtg tgtccttact gtaagaagcc atttaaacga ttaaaatccc acttgccata ctgtaagatg ataggaccaa ccatacctac tgatcaaaaa gtttatcagt ccaagccagc tacactccca cgtgctaaaa agatgaaagg accaatcaaa gatttaatta aagctaaagg gaaagagtta gagacagaga atgaagaaag aaattctaag ttggtggtgg acaaaccaga...
| Keywords: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
670.00€
*
Item number: ABS-PP-2701.100
| Keywords: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 15.5 kD |
From 90.00€
*
Item number: ABS-PQ-767.100
| Keywords: | Uncharacterized protein C17orf80, Cell migration-inducing gene 3 protein, Human lung cancer oncogene 8 protein, HLC-8,... |
| Expressed in: | human cells |
| Origin: | human |
| MW: | 37.5 kD |
From 270.00€
*
Item number: ATA-APrEST95893.100
PrEST Antigen C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Antigen sequence: PRETTYQFHSVSQSSSQSLASLATTFLQEKKAEAQNHNCVPDVKALMESPEGQLSLEPKSDSQFQASHTGCQSPLCSAQRHTPQSPFTNHAAAAGRKTLRSCMGLEWFPELYPGYLGLGVLPGKPQCWNAMTQKPQ, Storage: Upon delivery store...
| Keywords: | HLC8, HLC-8, C17orf80, Uncharacterized protein C17orf80, Human lung cancer oncogene 8 protein, Cell migration-inducing... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*