11 products were found matching "GeneID 54943"!

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 87%

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 62%

Polyclonal Antibody against Human DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Validated applications: ICC, Uniprot ID: Q9NX36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

DNAJC28 may have a role in protein folding or as a chaperone. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots...

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.

Length: 981 Sequence: atgaatacaa tgtatgtgat gatggctcag atcttaagat ctcacctgat aaaggctaca gtgattccta atcgagtgaa aatgcttcca tattttggta tcattagaaa tagaatgatg tcaacccata aatccaaaaa gaagatcaga gaatattata gactgctgaa cgtggaggaa ggatgctctg cagatgaagt cagggaatct tttcataagc ttgccaagca atatcatcct gacagtggct ctaatactgc...

Protein function: May have a role in protein folding or as a chaperone. [The UniProt Consortium]

PrEST Antigen DNAJC28, Gene description: DnaJ heat shock protein family (Hsp40) member C28, Alternative Gene Names: C21orf55, C21orf78, Antigen sequence: VLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAI, Storage: Upon delivery store at -20°C. Avoid repeated...