- Search results for GeneID 54752
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "GeneID 54752"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA026521.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA059803.100
Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-9760-L.100
| Keywords: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 115.00€
*
Item number: VHPS-3366
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Application: | RNA quantification |
45.00€
*
Item number: 035704.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Keywords: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST75528.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-9760.100
| Keywords: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 90.00€
*
Item number: ATA-APrEST96089.100
PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Keywords: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*