9 products were found matching "GeneID 54752"!

No results were found for the filter!
Anti-FNDC8
Anti-FNDC8

Item number: ATA-HPA026521.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%
Keywords: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Application: IHC, WB
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-FNDC8
Anti-FNDC8

Item number: ATA-HPA059803.100

Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Keywords: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-FNDC8
Anti-FNDC8

Item number: ATA-HPA059803.25

Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
Keywords: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
FNDC8, Human fibronectin type III domain containing 8, Real Time PCR Primer Set
FNDC8, Human fibronectin type III domain containing 8,...

Item number: VHPS-3366

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: FNDC8, Fibronectin type III domain-containing protein 8
Application: RNA quantification
45.00€ *
Review
Anti-FNDC8, ID (FNDC8, Fibronectin type III domain-containing protein 8)
Anti-FNDC8, ID (FNDC8, Fibronectin type III...

Item number: 035704.200

Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
Keywords: Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
FNDC8 PrEST Antigen
FNDC8 PrEST Antigen

Item number: ATA-APrEST75528.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: FNDC8, Fibronectin type III domain-containing protein 8
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
FNDC8 (human), recombinant protein
FNDC8 (human), recombinant protein

Item number: ABS-PP-9760.100

Keywords: Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein
Expressed in: E.coli
Origin: human
MW: 18.5 kD
From 90.00€ *
Review
FNDC8 PrEST Antigen
FNDC8 PrEST Antigen

Item number: ATA-APrEST96089.100

PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: FNDC8, Fibronectin type III domain-containing protein 8
Expressed in: E.coli
Origin: human
264.00€ *
Review
FNDC8 (human), recombinant protein
FNDC8 (human), recombinant protein

Item number: ABS-PP-9760-L.100

Keywords: Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein
Expressed in: E.coli
Origin: human
MW: 18.5 kD
From 115.00€ *
Review