8 products were found matching "GeneID 54752"!

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%

Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...

Buffer: PBS and 1M Urea, pH 7.4.

PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...