- Search results for GeneID 54537
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "GeneID 54537"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-PA597588.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
Item number: ATA-HPA057506.100
Polyclonal Antibody against Human SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Validated applications: IHC, Uniprot ID: Q86V20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-2403-L.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Keywords: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 115.00€
*
Item number: VHPS-3161
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | FAM35A, Protein FAM35A |
| Application: | RNA quantification |
45.00€
*
Item number: CSB-PA030133.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 126.00€
*
Item number: CSB-CL771442HU.10
Length: 2508 Sequence: atgagtggag gatctcaagt ccacattttt tggggtgctc caattgctcc actgaaaatc acagtatcag aagacacagc ttctttaatg tctgttgctg acccctggaa aaaaattcag cttttataca gtcaacattc tttatatctg aaggatgaaa aacagcacaa aaatcttgaa aactataaag tcccagaatc tattggttct ccagatctta gtggtcattt cttagcaaac tgtatgaata gacatgttca...
| Keywords: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
911.00€
*
Item number: ABS-PP-2403.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Keywords: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 90.00€
*
Item number: ATA-APrEST95845.100
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*