- Search results for GeneID 51368
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "GeneID 51368"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA017739.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Keywords: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Item number: ATA-HPA073223.100
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Keywords: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA073223.25
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Keywords: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
241.00€
*
Item number: ABS-PP-3416-L.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Keywords: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 13.5 kD |
From 115.00€
*
Item number: VHPS-10337
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | ZSIG11, TEX264, Putative secreted protein Zsig11, Testis-expressed sequence 264 protein |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST72149.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Keywords: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES12484.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Keywords: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11, TX264 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: ABS-PP-3416.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Keywords: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 13.5 kD |
From 90.00€
*
Item number: ATA-APrEST96222.100
PrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*