- Search results for GeneID 51248
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
17 products were found matching "GeneID 51248"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO36262.50
PDZD11 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. PDZD11 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is...
| Keywords: | Anti-AIPP1, Anti-PDZD11, Anti-HSPC227, Anti-ATPase-interacting PDZ protein, Anti-PDZ domain-containing protein 11,... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA003972.100
Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence...
| Keywords: | Anti-AIPP1, Anti-PDZD11, Anti-HSPC227, Anti-ATPase-interacting PDZ protein, Anti-PDZ domain-containing protein 11,... |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: NZY-PD00941
The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration.Sequence: NNELTQFLPR TITLKKPPGA QLGFNIRGGK ASQLGIFISK VIPDSDAHRA GLQEGDQVLA VNDVDFQDIE HSKAVEILKT AREISMRVRF FP. Components: PDZD11 PDZ Domain. Shipping Conditions:...
| Keywords: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Application: | Protein binding |
| MW: | 13,15 kD |
From 259.00€
*
Item number: CSB-EP707840HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-140aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MDSRIPYDDY PVVFLPAYEN PPAWIPPHER VHHPDYNNEL TQFLPRTITL KKPPGAQLGF NIRGGKASQL GIFISKVIPD SDAHRAGLQE GDQVLAVNDV DFQDIEHSKA VEILKTAREI SMRVRFFPYN...
| Keywords: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 32.1 kD |
From 219.00€
*
Item number: TGM-TMPY-01880-100ug
Description: PDZ domain-containing protein 11, also known as AIPP1a, PISP, PDZD11 and PDZK11, is a cytosolic protein that contains one PDZ (DHR) domain. PDZD11 bears resemblance to members of the MALS / VELIS family of proteins. It contains but one PDZ domain that apparently interacts with the C-terminus of partner...
| Keywords: | PISP, AIPP1, PDZK11, PDZ domain containing 11 |
| MW: | 16.9 kD |
768.00€
*
Item number: TGM-TMPY-01880-10ug
Description: PDZ domain-containing protein 11, also known as AIPP1a, PISP, PDZD11 and PDZK11, is a cytosolic protein that contains one PDZ (DHR) domain. PDZD11 bears resemblance to members of the MALS / VELIS family of proteins. It contains but one PDZ domain that apparently interacts with the C-terminus of partner...
| Keywords: | AIPP1 , PISP , PDZ domain containing 11 , PDZK11 |
| MW: | 16.9 kD |
From 75.00€
*
Item number: VHPS-6761
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | PDZK11, PDZD11, HSPC227, PDZ domain-containing protein 11 |
| Application: | RNA quantification |
45.00€
*
Item number: P3129-85.100
PDZD11 (PDZ domain-containing protein 11, also AIPP1a and PISP) is a 17kD cytosolic protein that bears resemblance to members of the MALS/VELIS family of proteins. It is ubiquitously expressed, and appears to target calcium and copper ATPases to basolateral cell membranes. Human PDZD11 is 140aa in length. It...
| Keywords: | Anti-PDZK11, Anti-HSPC227, Anti-PDZ domain-containing protein 11 |
| Application: | ELISA, WB |
| Host: | Goat |
| Species reactivity: | human |
1,039.00€
*
Item number: 374656.1
Source:, Recombinant protein corresponding to aa1-140 from human PDZD11, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.1kD, AA Sequence: MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH,...
| Keywords: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| MW: | 32,1 |
From 603.00€
*
Item number: ATA-APrEST74533.100
Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: E-PKSH030879.100
| Origin: | human |
924.00€
*
Item number: G-RPES3254.100
Human PDZD11/PDZK11/PISP Recombinant Protein (RPES3254) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding...
| Keywords: | AIPP1, PDZD11, HSPC227, ATPase-interacting PDZ protein, PDZ domain-containing protein 11, PMCA-interacting single-PDZ... |
| Expressed in: | E.coli |
| Origin: | human |
1,471.00€
*