11 products were found matching "GeneID 474354"!
No results were found for the filter!
Anti-LRRC18
Item number: G-PACO38790.50
LRRC18 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. LRRC18 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt...
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-LRRC18
Item number: ATA-HPA039256.100
Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 64%
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-LRRC18
Item number: ATA-HPA076699.100
Polyclonal Antibody against Human LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Validated applications: ICC, Uniprot ID: Q8N456, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-LRC18, CT (LRRC18, Leucine-rich repeat-containing...
Item number: 037919.200
May be involved in the regulation of spermatogenesis and sperm maturation (By similarity). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for...
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
LRRC18 PrEST Antigen
Item number: ATA-APrEST80316.100
Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
LRRC18 (Vector Vector will be determined during the...
Item number: CSB-CL839794HU.10
Length: 786 Sequence: atggttaagg gtgagaaagg ccccaagggc aagaagatca ccctcaaggt ggccaggaat tgcatcaaaa tcacttttga tgggaaaaag cgccttgact tgagcaagat gggaattacc accttcccca agtgtattct gcgccttagt gacatggacg agctggacct tagccggaat cttatcagga agatccctga ctccatctcc aagttccaga acctccggtg gctggacctg cacagcaact acatagacaa...
| Keywords: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-LRRC18
Item number: CSB-PA839794LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LRRC18, HRP conjugated
Item number: CSB-PA839794LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LRRC18, FITC conjugated
Item number: CSB-PA839794LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-LRRC18, Biotin conjugated
Item number: CSB-PA839794LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Keywords: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
LRRC18 PrEST Antigen
Item number: ATA-APrEST95713.100
PrEST Antigen LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Antigen sequence: PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*