- Search results for GeneID 397208
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
15 products were found matching "GeneID 397208"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG70212.20
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | SDS-PAGE, cell culture |
| Origin: | swine |
From 432.00€
*
Item number: G-AEES05441.480
Porcine GM-CSF (Granulocyte Macrophage Colony Stimulating Factor) Superset Max DIY ELISA Protein Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes [The Uniprot Consortium]
| Keywords: | CSF2, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
919.00€
*
Item number: CR-C03018-100UG
Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL ETSCETQSIT FKSFKDSLNK FLFTIPFDCW with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine that stimulates the growth and...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
From 312.00€
*
Item number: RP0940S-025
Produced in Yeast. Amino acid sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127).
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Bioassays |
| Expressed in: | Yeast |
| Origin: | swine |
| MW: | 14,4 kD |
From 233.00€
*
Item number: ARG82961.96
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF, CSF2, GM-CSF, GM-CSF, Colony-stimulating factor, Colony-stimulating factor, Granulocyte-macrophage... |
| Application: | ELISA |
| Species reactivity: | swine |
929.00€
*
Item number: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Application: | Active, Cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 17.08 kD |
435.00€
*
Item number: E-PKSS000024.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | swine |
| MW: | 17.08 kD |
192.00€
*
Item number: G-AEFI00782.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | Sandwich ELISA, Double Antibody |
| Species reactivity: | swine |
698.00€
*
Item number: G-RPES6867.5
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Expressed in: | E.coli |
306.00€
*
Item number: E-KAB-0622.1
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Porcine GM-CSF Antibody... |
| Application: | ELISA |
| Species reactivity: | swine |
1,093.00€
*
Item number: E-UNEL-P0015.1440
Type: Sandwich-ELISA. Detection Range: 1.56-100 pg/mL. Sensitivity: . Tested Sample Types: Serum, plasma. Test principle: Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
From 485.00€
*
Item number: DIY2245S-003
The Swine GM-CSF ELISA contains capture antibody, standard, and detection antibody for development of a Swine GM-CSF ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA...
| Keywords: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Application: | ELISA |
| Species reactivity: | swine |
From 1,098.00€
*