9 products were found matching "GeneID 344905"!
No results were found for the filter!
Anti-ATP13A5
Item number: ATA-HPA031771.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
| Keywords: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-ATP13A5
Item number: ATA-HPA031774.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
| Keywords: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-ATP13A5
Item number: ATA-HPA031772.100
Polyclonal Antibody against Human ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Validated applications: ICC, Uniprot ID: Q4VNC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene identity: 72%
| Keywords: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
ATP13A5 (human), recombinant protein
Item number: ABS-PP-3686-L.100
| Keywords: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 45.5 kD |
From 115.00€
*
ATP13A5 PrEST Antigen
Item number: ATA-APrEST77754.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ATP13A5 PrEST Antigen
Item number: ATA-APrEST77755.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-AT135
Item number: ELK-ES18221.100
Recommended dilutions: WB 1:500-2000. Cellular localization: Membrane , Multi-pass membrane protein .
| Keywords: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5, AT135 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
ATP13A5 (human), recombinant protein
Item number: ABS-PP-3686.100
| Keywords: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 45.5 kD |
From 90.00€
*
ATP13A5 PrEST Antigen
Item number: ATA-APrEST95842.100
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen sequence: FGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat gene identity: 72%
| Keywords: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*