1 products were found matching "GeneID 30835"!
No results were found for the filter!
GDF15, Recombinant, Human, aa198-308, His-Tag...
Item number: 373414.20
Source:, Recombinant protein corresponding to aa198-308 from human GDF15, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.2kD, AA Sequence: RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI, Storage and Stability: May be...
| Keywords: | NRG-1, NAG-1, MIC-1, GDF-15, Placental TGF-beta, NSAID-regulated gene 1 protein, NSAID-activated gene 1 protein, Prostate... |
| MW: | 16,2 |
From 603.00€
*