8 products were found matching "GeneID 295928"!

Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 130-233aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: WAYTCNISPG VEGQSLQRQQ QLGLWVIAGF LTFLALEKMF LNCKEEDPSQ APSKDPTAAA LNGGHCLAQP AAEPGLRAVV RNLKVSGYLN LLANTIDNFT HGLA. Purity: Greater than 90% as...

Acts as a zinc-influx transporter. Source: Recombinant protein corresponding to aa130-233 from rat Slc39a13, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA,...

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Slc39a13 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Slc39a13 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a zinc-influx transporter. [The UniProt Consortium]

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Slc39a13. Antigen Species: Rattus norvegicus (Rat)