4 products were found matching "GeneID 285971"!
No results were found for the filter!
Anti-ZNF775
Item number: ATA-HPA073171.100
Polyclonal Antibody against Human ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Validated applications: IHC, Uniprot ID: Q96BV0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
| Keywords: | Anti-ZNF775, Anti-Zinc finger protein 775 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-ZNF775, CT (ZNF775, Zinc finger protein 775)
Item number: 044361.200
ZNF775 may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Keywords: | Anti-ZNF775, Anti-Zinc finger protein 775 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Anti-ZN775
Item number: ELK-ES12107.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Keywords: | Anti-ZNF775, Anti-Zinc finger protein 775, ZN775 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
ZNF775 PrEST Antigen
Item number: ATA-APrEST96140.100
PrEST Antigen ZNF775, Gene description: zinc finger protein 775, Alternative Gene Names: MGC33584, Antigen sequence: GTGAGLVMKVKQEKPERLLQTLAPQAMLVEKDKENIFQQHRGLPPRQTMGRPRALGGQEESGSPRWAPPTEQDAGLAGRAPGSASGPLSPSLSSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
| Keywords: | ZNF775, Zinc finger protein 775 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
