- Search results for GeneID 285282
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 285282"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG59858.100
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
707.00€
*
Item number: ATA-HPA035150.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA035151.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA069861.100
Polyclonal Antibody against Human RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Validated applications: ICC, Uniprot ID: Q5HYI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Required for KRAS...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-9200-L.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 115.00€
*
Item number: ATA-APrEST79393.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | RABL3, Rab-like protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-APrEST79394.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | RABL3, Rab-like protein 3 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB14327.20
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3 |
| Application: | WB, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
103.00€
*
Item number: CSB-PA019239GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: RABL3. Antigen Species: Human
| Keywords: | Anti-RABL3, Anti-Rab-like protein 3, RAB member of RAS oncogene family like 3 antibody, Rab-like protein 3 antibody, RABL3... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
552.00€
*
Item number: ABS-PP-9200.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Keywords: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 18.5 kD |
From 90.00€
*
Item number: ATA-APrEST95921.100
PrEST Antigen RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Antigen sequence: NKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for KRAS...
| Keywords: | RABL3, Rab-like protein 3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*