20 products were found matching "GeneID 27006"!

1 from 2 pages
No results were found for the filter!
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Item number: 009-001-U78-0005

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Keywords: FGF22, FGF-22, Fibroblast growth factor 22
Application: Cell culture
Expressed in: E.coli
Origin: human
186.00€ *
Review
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Item number: 009-001-U78-0020

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Keywords: FGF22, FGF-22, Fibroblast growth factor 22
Application: Cell culture
Expressed in: E.coli
Origin: human
445.00€ *
Review
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Item number: 009-001-U78-0100

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Keywords: FGF22, FGF-22, Fibroblast growth factor 22
Application: Cell culture
Expressed in: E.coli
Origin: human
1,466.00€ *
Review
Anti-FGF22
Anti-FGF22

Item number: NSJ-R30527

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fibroblast growth factor 22, is a protein which in humans is encoded by the FGF22 gene. The FGF22 sequence in a genomic clone is assigned to 19p13.3. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members...
Keywords: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF22 Antibody
Application: WB
Host: Rabbit
Species reactivity: human, mouse, rat
790.00€ *
Review
Human FGF22 recombinant protein (Active)
Human FGF22 recombinant protein (Active)

Item number: ARG70128.100

Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. [The UniProt Consortium]
Keywords: FGF22, FGF-22, Fibroblast growth factor 22
Application: SDS-PAGE, Cell culture
Origin: human
From 345.00€ *
Review
Fibroblast growth factor 22 (FGF22), human, recombinant
Fibroblast growth factor 22 (FGF22), human, recombinant

Item number: CSB-EP008628HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-170aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: TPSASRGPRS YPHLEGDVRW RRLFSSTHFF LRVDPGGRVQ GTRWRHGQDS ILEIRSVHVG VVVIKAVSSG FYVAMNRRGR LYGSRLYTVD CRFRERIEEN GHNTYASQRW...
Keywords: FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human Fibroblast growth factor 22 (FGF22)
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 30.1 kD
From 247.00€ *
Review
Anti-FGF22
Anti-FGF22

Item number: CSB-PA002519.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN...
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human, mouse, rat
From 126.00€ *
Review
Anti-FGF22
Anti-FGF22

Item number: CSB-PA077924.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FGF22. Antigen Species: Human
Keywords: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human, mouse
From 167.00€ *
Review
Human FGF22 (Fibroblast growth factor 22) ELISA Kit
Human FGF22 (Fibroblast growth factor 22) ELISA Kit

Item number: G-AEKE12235.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human FGF22. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human FGF22. Next,...
Keywords: FGF22, Fibroblast growth factor 22
Application: ELISA
Species reactivity: swine
801.00€ *
Review
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22) (Azide Free) (Biotin)
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)...

Item number: 035623-Biotin.200

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
Keywords: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
1,104.00€ *
Review
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)

Item number: 035623.200

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
Keywords: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
FGF-22 protein(N-His)(active) (recombinant human)
FGF-22 protein(N-His)(active) (recombinant human)

Item number: E-PKSH034161.100

Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL. Sequence: MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS. Fusion tag: N-His Endotoxin:...
Keywords: FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human FGF-22 protein(N-His)(active)
Application: Active, cell culture
Expressed in: E.coli
Origin: human
MW: 20.49 kD
From 241.00€ *
Review
1 from 2 pages