- Search results for GeneID 27006
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
20 products were found matching "GeneID 27006"!
Close filters
Filter by:
No results were found for the filter!
Item number: 009-001-U78-0005
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
186.00€
*
Item number: 009-001-U78-0020
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
445.00€
*
Item number: 009-001-U78-0100
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Application: | Cell culture |
| Expressed in: | E.coli |
| Origin: | human |
1,466.00€
*
Item number: NSJ-R30527
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fibroblast growth factor 22, is a protein which in humans is encoded by the FGF22 gene. The FGF22 sequence in a genomic clone is assigned to 19p13.3. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members...
| Keywords: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF22 Antibody |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
790.00€
*
Item number: ARG70128.100
Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. [The UniProt Consortium]
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Application: | SDS-PAGE, Cell culture |
| Origin: | human |
From 345.00€
*
Item number: CSB-EP008628HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-170aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: TPSASRGPRS YPHLEGDVRW RRLFSSTHFF LRVDPGGRVQ GTRWRHGQDS ILEIRSVHVG VVVIKAVSSG FYVAMNRRGR LYGSRLYTVD CRFRERIEEN GHNTYASQRW...
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human Fibroblast growth factor 22 (FGF22) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 30.1 kD |
From 247.00€
*
Item number: CSB-PA002519.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 126.00€
*
Item number: CSB-PA077924.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FGF22. Antigen Species: Human
| Keywords: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 167.00€
*
Item number: G-AEKE12235.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human FGF22. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human FGF22. Next,...
| Keywords: | FGF22, Fibroblast growth factor 22 |
| Application: | ELISA |
| Species reactivity: | swine |
801.00€
*
Item number: 035623-Biotin.200
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
| Keywords: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
1,104.00€
*
Item number: 035623.200
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
| Keywords: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: E-PKSH034161.100
Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL. Sequence: MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS. Fusion tag: N-His Endotoxin:...
| Keywords: | FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human FGF-22 protein(N-His)(active) |
| Application: | Active, cell culture |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 20.49 kD |
From 241.00€
*