12 products were found matching "GeneID 2537"!
No results were found for the filter!
Human Interferon alpha-inducible protein 6 / IFI6 ELISA Kit
Item number: G-HUFI01005.96
| Application: | ELISA |
| Species reactivity: | human |
698.00€
*
Interferon alpha-inducible protein 6 (IFI6), human,...
Item number: CSB-EP011016HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity:...
| Keywords: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 24.4 kD |
From 219.00€
*
Interferon alpha-inducible protein 6 (IFI6), human,...
Item number: CSB-YP011016HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 24-130aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GKKKCSESSD SGSGFWKALT FMAVGGGLAV AGLPALGFTG AGIAANSVAA SLMSWSAILN GGGVPAGGLV ATLQSLGAGG SSVVIGNIGA LMGYATHKYL DSEEDEE. Purity: Greater...
| Keywords: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, Recombinant Human Interferon... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 12.4 kD |
From 242.00€
*
Anti-IFI6
Item number: CSB-PA253751.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, Ifi-6-16 antibody, IFI6... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
284.00€
*
IFI6 Protein, Human, Recombinant (B2M & His)
Item number: TGM-TMPH-01548-100ug
Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
| Keywords: | Interferon-induced protein 6-16, Interferon alpha-inducible protein 6, IFI6 |
| MW: | 24.4 kD |
From 187.00€
*
IFI6 Protein, Human, Recombinant (B2M & His)
Item number: TGM-TMPH-01548-10ug
Description: Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been shown to have a pro-apoptotic activity. Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation...
| Keywords: | Interferon alpha-inducible protein 6 , G1P3 , Interferon-induced protein 6-16 (Ifi-6-16) , IFI6 |
| MW: | 24.4 kD |
From 71.00€
*
Anti-IFI6, NT (IFI6, G1P3, Interferon alpha-inducible...
Item number: 036879.200
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
| Keywords: | Anti-G1P3, Anti-IFI6, Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
IFI6, Recombinant, Human, aa24-130, His-B2M-Tag...
Item number: 373737.1
Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.4kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored...
| Keywords: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| MW: | 24,4 |
From 603.00€
*
IFI6, Recombinant, Human, aa24-130, His-Tag (Interferon...
Item number: 373738.100
Source:, Recombinant protein corresponding to aa24-130 from human IFI6, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.3kD, AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE, Storage and Stability: May be stored at 4°C...
| Keywords: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| MW: | 12,3 |
From 557.00€
*
Anti-IFI6
Item number: ELK-ES10713.100
This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of...
| Keywords: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
IFI6 (Vector pUC, Accession No. BC011601)
Item number: CSB-CL011016HU.10
Length: 393 Sequence: atgcggcaga aggcggtatc gcttttcttg tgctacctgc tgctcttcac ttgcagtggg gtggaggcag gtaagaaaaa gtgctcggag agctcggaca gcggctccgg gttctggaag gccctgacct tcatggccgt cggaggagga ctcgcagtcg ccgggctgcc cgcgctgggc ttcaccggcg ccggcatcgc ggccaactcg gtggctgcct cgctgatgag ctggtctgcg atcctgaatg ggggcggcgt...
| Keywords: | Ifi-6-16, Interferon-induced protein 6-16, Interferon alpha-inducible protein 6 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
160.00€
*
Anti-IFI6
Item number: CSB-PA011016ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-Ifi-6-16, Anti-Interferon-induced protein 6-16, Anti-Interferon alpha-inducible protein 6, IFI6 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Homo sapiens (Human) |
From 1,529.00€
*