- Search results for GeneID 24694
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "GeneID 24694"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG82254.96
Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Application: | ELISA |
| Species reactivity: | rat |
1,850.00€
*
Item number: E-PDER100658.1
Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Keywords: | PTH, Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag) |
| Expressed in: | E.coli |
| Origin: | rat |
From 192.00€
*
Item number: E-PDER100113.1
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
| Keywords: | Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag) |
From 192.00€
*
Item number: CSB-E07866r.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: PTH elevates calcium level by dissolving the salts in bone and...
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | rat |
From 711.00€
*
Item number: G-RPES8228.20
Endotoxin level: < 10 EU/mg of the protein as determined by the LAL method. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Expressed in: | E.coli |
| Origin: | rat |
306.00€
*
Item number: 000-001-M31
Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
634.00€
*
Item number: 000-001-M32
Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
472.00€
*
Item number: VRPS-4911
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | PTH, Pth, Parathyrin, Parathyroid hormone |
| Application: | RNA quantification |
54.00€
*
Item number: 298235.1
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH , AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, Storage and Stability:...
| Keywords: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Origin: | rat |
From 477.00€
*
Item number: G-AEES00445.96
ELISA Type: Sandwich. Detection Range: 15.63-1000µg/mL. Sensitivity: 9.38µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and...
| Keywords: | PTH, Pth, Parathyrin, Parathyroid hormone |
| Application: | Sandwich |
| Species reactivity: | rat |
708.00€
*
Item number: CSB-PA018987ZA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-PTH, Anti-Pth, Anti-Parathyrin, Anti-Parathyroid hormone, Pth Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Rattus norvegicus (Rat) |
From 1,529.00€
*