13 products were found matching "GeneID 23670"!
No results were found for the filter!
Anti-CEMIP2 / Cell migration-inducing and...
Item number: NSJ-FY12150
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. CEMIP2 antibody detects Cell migration-inducing and hyaluronan-binding protein 2, encoded by the CEMIP2 gene on chromosome 15q25.3. CEMIP2 antibody is widely used to study this hyaluronidase-like protein, also called TMEM2, which plays...
| Keywords: | Anti-CEMIP2, Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase CEMIP2, Anti-Cell migration-inducing... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
790.00€
*
Anti-TMEM2
Item number: ATA-HPA044889.100
Protein function: Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate- size hyaluronan of approximately 5 kDa fragments (PubMed:28246172). Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of...
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2 |
| Application: | WB, IHC, ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 330.00€
*
Cell surface hyaluronidase (TMEM2), partial, human,...
Item number: CSB-YP023791HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 104-250aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SSKYAPDENC PDQNPRLRNW DPGQDSAKQV VIKEGDMLRL TSDATVHSIV IQDGGLLVFG DNKDGSRNIT LRTHYILIQD GGALHIGAEK CRYKSKATIT LYGKSDEGES MPTFGKKFIG VEAGGTLELH GARKASWTLL...
| Keywords: | Transmembrane protein 2, Cell surface hyaluronidase, Cell migration-inducing hyaluronidase 2, Recombinant Human Cell... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 18.0 kD |
From 292.00€
*
Cell surface hyaluronidase (TMEM2), partial, human,...
Item number: CSB-EP023791HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 104-250aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: SSKYAPDENC PDQNPRLRNW DPGQDSAKQV VIKEGDMLRL TSDATVHSIV IQDGGLLVFG DNKDGSRNIT LRTHYILIQD GGALHIGAEK CRYKSKATIT LYGKSDEGES MPTFGKKFIG VEAGGTLELH GARKASWTLL...
| Keywords: | Transmembrane protein 2, Cell surface hyaluronidase, Cell migration-inducing hyaluronidase 2, Recombinant Human Cell... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21.5 kD |
From 247.00€
*
Anti-TMEM2
Item number: CSB-PA23279A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMEM2. Antigen Species: Human
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2, KIAA1412... |
| Application: | ELISA, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-CEMIP2
Item number: ATA-HPA017080.100
Polyclonal Antibody against Human CEMIP2, Gene description: cell migration inducing hyaluronidase 2, Alternative Gene Names: TMEM2, Validated applications: ICC, Uniprot ID: Q9UHN6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Cell surface hyaluronidase...
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
TMEM2, Human transmembrane protein 2, Real Time PCR...
Item number: VHPS-9369
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | TMEM2, KIAA1412, Transmembrane protein 2 |
| Application: | RNA quantification |
45.00€
*
TMEM2 PrEST Antigen
Item number: ATA-APrEST71942.100
Protein function: Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate- size hyaluronan of approximately 5 kDa fragments (PubMed:28246172). Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of...
| Keywords: | Transmembrane protein 2, Cell surface hyaluronidase, Cell migration-inducing hyaluronidase 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-TMEM2, HRP conjugated
Item number: CSB-PA23279B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMEM2. Antigen Species: Human
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2, KIAA1412... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TMEM2, FITC conjugated
Item number: CSB-PA23279C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMEM2. Antigen Species: Human
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2, KIAA1412... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-TMEM2, Biotin conjugated
Item number: CSB-PA23279D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMEM2. Antigen Species: Human
| Keywords: | Anti-Transmembrane protein 2, Anti-Cell surface hyaluronidase, Anti-Cell migration-inducing hyaluronidase 2, KIAA1412... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
CEMIP2 PrEST Antigen
Item number: ATA-APrEST95571.100
PrEST Antigen CEMIP2, Gene description: cell migration inducing hyaluronidase 2, Alternative Gene Names: TMEM2, Antigen sequence: GDPSVISVNGTDFTFRSAGVLLLVVDPCSVPFRLTEKTVFPLADVSRIEEYLKTGIPPRSIVLLSTRGEIKQLNISHLLVPLGLAKPAHLYDKGSTIFLGFSGNFKPSWTKLFTSPAGQGLGVLEQFIPLQLDEYGCPR, Storage: Upon delivery store at -20°C. Avoid...
| Keywords: | Transmembrane protein 2, Cell surface hyaluronidase, Cell migration-inducing hyaluronidase 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*