12 products were found matching "GeneID 23101"!
No results were found for the filter!
Anti-MCF2L2
Item number: ATA-HPA038946.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 30% and to rat: 29%
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-MCF2L2
Item number: ATA-HPA038947.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 28%
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-MCF2L2
Item number: ABS-KC-2717.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-MCF2L2
Item number: ABS-KC-2724.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-MCF2L2
Item number: ATA-HPA061485.100
Polyclonal Antibody against Human MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Validated applications: ICC, Uniprot ID: Q86YR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-MCF2L2
Item number: ABS-KC-17179.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
MCF2L2 (human), recombinant protein
Item number: ABS-PP-9046-L.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 58.5 kD |
From 115.00€
*
MCF2L2 PrEST Antigen
Item number: ATA-APrEST79286.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MCF2L2 PrEST Antigen
Item number: ATA-APrEST79287.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-MF2L2
Item number: ELK-ES19613.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:
| Keywords: | Anti-MCF2L2, Anti-ARHGEF22, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
MCF2L2 (human), recombinant protein
Item number: ABS-PP-9046.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Keywords: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 58.5 kD |
From 90.00€
*
MCF2L2 PrEST Antigen
Item number: ATA-APrEST95865.100
PrEST Antigen MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Antigen sequence: MLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDF, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*