6 products were found matching "GeneID 221806"!
No results were found for the filter!
Anti-VWDE
Item number: ATA-HPA026619.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 90% and to rat: 87%
| Keywords: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-VWDE
Item number: ATA-HPA036044.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Keywords: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-VWDE
Item number: ATA-HPA036045.100
Polyclonal Antibody against Human VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Validated applications: ICC, Uniprot ID: Q8N2E2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | Anti-VWDE, Anti-von Willebrand factor D and EGF domain-containing protein |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
VWDE PrEST Antigen
Item number: ATA-APrEST70181.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
VWDE PrEST Antigen
Item number: ATA-APrEST74997.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
VWDE PrEST Antigen
Item number: ATA-APrEST95602.100
PrEST Antigen VWDE, Gene description: von Willebrand factor D and EGF domains, Alternative Gene Names: FLJ14712, Antigen sequence: LLTTQQITVRLNDDCDAETRVTIEVTVKSCDCLNGGSCVSDRNFSPGSGVYLCVCLPGFHGSLCEVDISGCQSNPCGLGSYISGFHSYSCDCPPELKVETQFVNQFTTQTVVLTRSDKSVN, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | VWDE, von Willebrand factor D and EGF domain-containing protein |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*