11 products were found matching "GeneID 20284"!

No results were found for the filter!
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant

Item number: CSB-YP526023MO.1

Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
Keywords: Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive...
Application: Activity not tested
Expressed in: Yeast
Origin: mouse
MW: 11 kD
From 347.00€ *
Review
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant

Item number: CSB-EP526023MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
Keywords: Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive...
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 25 kD
From 292.00€ *
Review
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant

Item number: CSB-EP526023MOa0.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 85% as determined by...
Keywords: Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive...
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 15.0 kD
From 292.00€ *
Review
SCRG1 Protein, Mouse, Recombinant (His)
SCRG1 Protein, Mouse, Recombinant (His)

Item number: TGM-TMPH-02887-10ug

Description: SCRG1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.0 kDa and the accession number is O88745?.
Keywords: Scrapie-responsive protein 1 , Scrg1 , Scrapie-responsive gene 1 protein
MW: 15 kD
From 99.00€ *
Review
Scrg1, Mouse scrapie responsive gene 1, Real Time PCR Primer Set
Scrg1, Mouse scrapie responsive gene 1, Real Time PCR...

Item number: VMPS-5717

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
Application: RNA quantification
45.00€ *
Review
Anti-Scrg1
Anti-Scrg1

Item number: G-PACO35130.50

Scrg1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scrg1 Antibody is a high quality polyclonal antibody for research use only.
Keywords: Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein
Application: ELISA
Host: Rabbit
Species reactivity: mouse
313.00€ *
Review
Scrg1, Recombinant, Mouse, aa21-98, His-Tag (Scrapie-responsive Protein 1)
Scrg1, Recombinant, Mouse, aa21-98, His-Tag...

Item number: 375227.100

Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot...
Keywords: Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein
MW: 11
From 636.00€ *
Review
Anti-Scrg1, FITC conjugated
Anti-Scrg1, FITC conjugated

Item number: CSB-PA526023HC01MO.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
Keywords: Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,...
Host: Rabbit
Species reactivity: mouse
From 167.00€ *
Review
Anti-Scrg1, Biotin conjugated
Anti-Scrg1, Biotin conjugated

Item number: CSB-PA526023HD01MO.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
Keywords: Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: mouse
From 167.00€ *
Review
Anti-Scrg1
Anti-Scrg1

Item number: CSB-PA526023HA01MO.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
Keywords: Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: mouse
From 167.00€ *
Review
Anti-Scrg1, HRP conjugated
Anti-Scrg1, HRP conjugated

Item number: CSB-PA526023HB01MO.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
Keywords: Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: mouse
From 167.00€ *
Review