- Search results for GeneID 20284
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 20284"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-YP526023MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Keywords: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 11 kD |
From 347.00€
*
Item number: CSB-EP526023MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Keywords: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 25 kD |
From 292.00€
*
Item number: CSB-EP526023MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 85% as determined by...
| Keywords: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 15.0 kD |
From 292.00€
*
Item number: TGM-TMPH-02887-10ug
Description: SCRG1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.0 kDa and the accession number is O88745?.
| Keywords: | Scrapie-responsive protein 1 , Scrg1 , Scrapie-responsive gene 1 protein |
| MW: | 15 kD |
From 99.00€
*
Item number: VMPS-5717
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Application: | RNA quantification |
45.00€
*
Item number: G-PACO35130.50
Scrg1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scrg1 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
313.00€
*
Item number: 375227.100
Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot...
| Keywords: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 11 |
From 636.00€
*
Item number: CSB-PA526023HC01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Keywords: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Item number: CSB-PA526023HD01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Keywords: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Item number: CSB-PA526023HA01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Keywords: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Item number: CSB-PA526023HB01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Keywords: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*