- Search results for GeneID 20208
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
16 products were found matching "GeneID 20208"!
Close filters
Filter by:
No results were found for the filter!
Item number: ARG81841.96
Protein function: Major acute phase protein. [The UniProt Consortium]
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA |
| Species reactivity: | mouse |
1,118.00€
*
Item number: CSB-EP020656MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity:...
| Keywords: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 27.8 kD |
From 292.00€
*
Item number: CSB-EP020656MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity: Greater...
| Keywords: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 17 kD |
From 292.00€
*
Item number: TGM-TMPH-02900-100ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Keywords: | Serum amyloid A-1 protein, Saa1 |
| MW: | 17 kD |
From 266.00€
*
NEW
Item number: G-AEKE04203.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA |
| Species reactivity: | human |
694.00€
*
NEW
Item number: G-AEES05482.480
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA Protein Function: Major acute phase protein [The Uniprot Consortium]
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA |
| Species reactivity: | mouse |
919.00€
*
NEW
Item number: TGM-TMPH-02900-10ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Keywords: | Saa1 , Serum amyloid A-1 protein |
| MW: | 17 kD |
From 99.00€
*
Item number: CSB-EL020656MO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 3.12 ng/ml - 200 ng/ml Sensitivity: 0.78 ng/ml Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Major acute phase protein. [The UniProt Consortium]
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | mouse |
From 581.00€
*
Item number: ELK-ELK10304.48
Major acute phase protein Assay Type: Sandwich. Sensitivity: 2.67 ng/mL. Standard: 500 ng/mL. Detection range: 7.81-500 ng/mL. Sample type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Assay length: 3.5h. Research Field: Infection immunity,Kidney...
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA |
| Species reactivity: | mouse |
From 374.00€
*
Item number: 517642.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
| Keywords: | Saa1, Serum amyloid A-1 protein |
| Application: | ELISA |
| Species reactivity: | mouse |
1,065.00€
*
Item number: 375189.100
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
| Keywords: | Saa1, Serum amyloid A-1 protein |
| MW: | 27,8 |
From 690.00€
*
Item number: E-KAB-0716.1
Matched antibody pair. Protein function: Major acute phase protein. [The UniProt Consortium]
| Keywords: | Saa1, Serum amyloid A-1 protein, Mouse SAA Antibody Pair Set |
| Application: | ELISA |
| Species reactivity: | mouse |
1,093.00€
*