- Search results for GeneID 200350
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "GeneID 200350"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO02639.50
FOXD4L1 Antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. FOXD4L1 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
225.00€
*
Item number: CSB-PA008024.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, bA395L14.1 antibody, Forkhead box D4 like 1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
126.00€
*
Item number: ATA-HPA069839.100
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Item number: ATA-HPA069839.25
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ABS-PP-2828-L.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.5 kD |
From 115.00€
*
Item number: ABS-PP-2829-L.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.5 kD |
From 115.00€
*
Item number: 600-401-BG2
Anti-FOXD4L1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to not cross-react with any FOXD4 protein family members
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
848.00€
*
Item number: 035808.200
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ELK-ES5100.100
forkhead box D4-like 1(FOXD4L1) Homo sapiens This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, FoxD4L1 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
Item number: ABS-PP-2828.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.5 kD |
From 90.00€
*
Item number: ABS-PP-2829.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.5 kD |
From 90.00€
*
Item number: ATA-APrEST96047.100
PrEST Antigen FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Antigen sequence: GTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | FOXD4L1, FOXD4-like 1, Forkhead box protein D4-like 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*