12 products were found matching "GeneID 200350"!
No results were found for the filter!
Anti-FOXD4L1 (PACO02639)
Item number: G-PACO02639.50
FOXD4L1 Antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. FOXD4L1 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
225.00€
*
Anti-FOXD4L1
Item number: CSB-PA008024.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, bA395L14.1 antibody, Forkhead box D4 like 1... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
126.00€
*
Anti-FOXD4L1
Item number: ATA-HPA069839.100
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Anti-FOXD4L1
Item number: ATA-HPA069839.25
Polyclonal Antibody against Human FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Validated applications: ICC, Uniprot ID: Q9NU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
FOXD4L1 (human), recombinant protein
Item number: ABS-PP-2828-L.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.5 kD |
From 115.00€
*
FOXD4L1 (human), recombinant protein
Item number: ABS-PP-2829-L.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.5 kD |
From 115.00€
*
Anti-FOXD4L1
Item number: 600-401-BG2
Anti-FOXD4L1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. This antibody is predicted to not cross-react with any FOXD4 protein family members
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
848.00€
*
Anti-FX4L1, NT (FOXD4L1, Forkhead box protein D4-like 1)
Item number: 035808.200
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1 |
| Application: | ELISA, FC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Anti-FoxD4L1
Item number: ELK-ES5100.100
forkhead box D4-like 1(FOXD4L1) Homo sapiens This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies...
| Keywords: | Anti-FOXD4L1, Anti-FOXD4-like 1, Anti-Forkhead box protein D4-like 1, FoxD4L1 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
FOXD4L1 (human), recombinant protein
Item number: ABS-PP-2828.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 31.5 kD |
From 90.00€
*
FOXD4L1 (human), recombinant protein
Item number: ABS-PP-2829.100
| Keywords: | Forkhead box protein D4-like 1, FOXD4-like 1, Recombinant Human FOXD4L1 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.5 kD |
From 90.00€
*
FOXD4L1 PrEST Antigen
Item number: ATA-APrEST96047.100
PrEST Antigen FOXD4L1, Gene description: forkhead box D4 like 1, Alternative Gene Names: FOXD5, Antigen sequence: GTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 56% Rat gene identity: 56%
| Keywords: | FOXD4L1, FOXD4-like 1, Forkhead box protein D4-like 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*