- Search results for GeneID 1842
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
6 products were found matching "GeneID 1842"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA035347.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Keywords: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ATA-HPA035348.100
Polyclonal Antibody against Human ECM2, Gene description: extracellular matrix protein 2, Validated applications: ICC, Uniprot ID: O94769, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
| Keywords: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: VHPS-2834
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Application: | RNA quantification |
45.00€
*
Item number: ATA-APrEST75192.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES19310.100
Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization: Secreted, extracellular space, extracellular matrix .
| Keywords: | Anti-ECM2, Anti-Matrix glycoprotein SC1/ECM2, Anti-Extracellular matrix protein 2, ECM2 rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: ATA-APrEST95917.100
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, Antigen sequence: RVLCDETMCHPQRCPQTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt...
| Keywords: | ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*