12 products were found matching "GeneID 1783"!

No results were found for the filter!
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: ATA-HPA057201.100

Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: ICC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: ATA-HPA049538.100

Polyclonal Antibody against Human DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Validated applications: IHC, WB, Uniprot ID: O43237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Acts as one...
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: IHC, WB
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: E-AB-92302.120

Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins. Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in...
Keywords: LIC-2, DNCLI2, LIC53/55, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate chain 2,...
Application: WB, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
From 243.00€ *
Review
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: ATA-HPA049538.25

Polyclonal Antibody against Human DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Validated applications: IHC, WB, Uniprot ID: O43237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Acts as one...
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: IHC, WB
Host: Rabbit
Species reactivity: human
361.00€ *
Review
DNCLI2, Human, Real Time PCR Primer Set
DNCLI2, Human, Real Time PCR Primer Set

Item number: VHPS-2687

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: LIC-2, DNCLI2, DYNC1LI2, LIC53/55, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate...
Application: RNA quantification
45.00€ *
Review
Anti-DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein l
Anti-DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic...

Item number: 034873.200

Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins. Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
DYNC1LI2 PrEST Antigen
DYNC1LI2 PrEST Antigen

Item number: ATA-APrEST91790.100

Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
Keywords: LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: G-CAB20592.20

Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-DYNC1LI2, Anti-LIC53/55, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: WB, IHC
Host: Rabbit
Species reactivity: human, mouse, rat
103.00€ *
Review
Anti-DYNC1LI2
Anti-DYNC1LI2

Item number: CSB-PA007296GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: DYNC1LI2. Antigen Species: Human
Keywords: Anti-LIC-2, Anti-DNCLI2, Anti-LIC53/55, Anti-DYNC1LI2, Anti-Dynein light intermediate chain 2, cytosolic, Anti-Cytoplasmic...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, rat
552.00€ *
Review
DYNC1LI2 (human), recombinant protein
DYNC1LI2 (human), recombinant protein

Item number: ABS-PP-7532.100

Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
Keywords: Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,...
Expressed in: E.coli
Origin: human
MW: 15.5 kD
From 90.00€ *
Review
DYNC1LI2 PrEST Antigen
DYNC1LI2 PrEST Antigen

Item number: ATA-APrEST95624.100

PrEST Antigen DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Antigen sequence: PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Acts as one of several non-catalytic...
Keywords: LIC-2, DNCLI2, LIC53/55, DYNC1LI2, Dynein light intermediate chain 2, cytosolic, Cytoplasmic dynein 1 light intermediate...
Expressed in: E.coli
Origin: human
264.00€ *
Review
DYNC1LI2 (human), recombinant protein
DYNC1LI2 (human), recombinant protein

Item number: ABS-PP-7532-L.100

Protein function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles...
Keywords: Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC-2, LIC53/55,...
Expressed in: E.coli
Origin: human
MW: 15.5 kD
From 115.00€ *
Review