- Search results for GeneID 17069
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
18 products were found matching "GeneID 17069"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPH-02767-10ug
Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
| Keywords: | Tsa-1 , Ly-6E , Ly67 , Sca-2 , Lymphocyte antigen 6E , Ly6e , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2 |
| MW: | 24.8 kD |
From 115.00€
*
Item number: TGM-TMPH-04292-100ug
Description: LY6E Protein, Mouse, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is Q64253.
| Keywords: | Thymic shared antigen 1 (TSA-1) , Ly6e , Ly67 , Lymphocyte antigen 6E , Tsa-1 , Sca-2 , Stem cell antigen 2 , Ly-6E |
| MW: | 12.9 kD |
From 93.00€
*
Item number: ARG65280.100
Protein function: Involved in T-cell development. [The UniProt Consortium]
| Keywords: | Anti-Ly67, Anti-Ly6e, Anti-Ly-6E, Anti-TSA-1, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared... |
| Application: | ELISA, IHC (paraffin) |
| Host: | Goat |
| Species reactivity: | mouse |
871.00€
*
Item number: G-PACO36374.50
Ly6e Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Human and for use in ELISA, WB applications. Ly6e Antibody is a high quality polyclonal antibody for research use only.. Protein function: GPI-anchored cell surface protein that regulates T- lymphocytes proliferation,...
| Keywords: | Anti-Ly67, Anti-TSA-1, Anti-Ly-6E, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared antigen 1 |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | mouse, human |
313.00€
*
Item number: CSB-YP717533MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
| Keywords: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 24.8 kD |
From 347.00€
*
Item number: CSB-EP717533MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
| Keywords: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 22.8 kD |
From 292.00€
*
Item number: CSB-EP717533MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 95% as determined by...
| Keywords: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 12.9 kD |
From 292.00€
*
Item number: CSB-EP717533MOb1.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity:...
| Keywords: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 13.8 kD |
From 292.00€
*
Item number: TGM-TMPH-02766-100ug
Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
| Keywords: | Lymphocyte antigen 6E, Ly6e, Thymic shared antigen 1, Stem cell antigen 2 |
| MW: | 22.8 kD |
From 266.00€
*
Item number: TGM-TMPH-02767-100ug
Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
| Keywords: | Ly6e, Stem cell antigen 2, Thymic shared antigen 1, Lymphocyte antigen 6E |
| MW: | 24.8 kD |
From 320.00€
*
Item number: TGM-TMPH-02766-10ug
Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
| Keywords: | Ly67 , Ly-6E , Sca-2 , Tsa-1 , Ly6e , Lymphocyte antigen 6E , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2 |
| MW: | 22.8 kD |
From 99.00€
*
Item number: 374096.100
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
| Keywords: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| MW: | 22,8 |
From 690.00€
*