18 products were found matching "GeneID 17069"!

1 from 2 pages
No results were found for the filter!
LY6E Protein, Mouse, Recombinant (His & SUMO)
LY6E Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02767-10ug

Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
Keywords: Tsa-1 , Ly-6E , Ly67 , Sca-2 , Lymphocyte antigen 6E , Ly6e , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2
MW: 24.8 kD
From 115.00€ *
Review
LY6E Protein, Mouse, Recombinant (His)
LY6E Protein, Mouse, Recombinant (His)

Item number: TGM-TMPH-04292-100ug

Description: LY6E Protein, Mouse, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is Q64253.
Keywords: Thymic shared antigen 1 (TSA-1) , Ly6e , Ly67 , Lymphocyte antigen 6E , Tsa-1 , Sca-2 , Stem cell antigen 2 , Ly-6E
MW: 12.9 kD
From 93.00€ *
Review
Anti-LY6E, Internal
Anti-LY6E, Internal

Item number: ARG65280.100

Protein function: Involved in T-cell development. [The UniProt Consortium]
Keywords: Anti-Ly67, Anti-Ly6e, Anti-Ly-6E, Anti-TSA-1, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared...
Application: ELISA, IHC (paraffin)
Host: Goat
Species reactivity: mouse
871.00€ *
Review
Anti-Ly6e
Anti-Ly6e

Item number: G-PACO36374.50

Ly6e Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Human and for use in ELISA, WB applications. Ly6e Antibody is a high quality polyclonal antibody for research use only.. Protein function: GPI-anchored cell surface protein that regulates T- lymphocytes proliferation,...
Keywords: Anti-Ly67, Anti-TSA-1, Anti-Ly-6E, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared antigen 1
Application: ELISA, WB
Host: Rabbit
Species reactivity: mouse, human
313.00€ *
Review
Lymphocyte antigen 6E (Ly6e), mouse, recombinant
Lymphocyte antigen 6E (Ly6e), mouse, recombinant

Item number: CSB-YP717533MO.1

Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
Keywords: Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte...
Application: Activity not tested
Expressed in: Yeast
Origin: mouse
MW: 24.8 kD
From 347.00€ *
Review
Lymphocyte antigen 6E (Ly6e), mouse, recombinant
Lymphocyte antigen 6E (Ly6e), mouse, recombinant

Item number: CSB-EP717533MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
Keywords: Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte...
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 22.8 kD
From 292.00€ *
Review
Lymphocyte antigen 6E (Ly6e), mouse, recombinant
Lymphocyte antigen 6E (Ly6e), mouse, recombinant

Item number: CSB-EP717533MOa0.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 95% as determined by...
Keywords: Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte...
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 12.9 kD
From 292.00€ *
Review
Lymphocyte antigen 6E (Ly6e), mouse, recombinant
Lymphocyte antigen 6E (Ly6e), mouse, recombinant

Item number: CSB-EP717533MOb1.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity:...
Keywords: Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte...
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 13.8 kD
From 292.00€ *
Review
LY6E Protein, Mouse, Recombinant (B2M & His)
LY6E Protein, Mouse, Recombinant (B2M & His)

Item number: TGM-TMPH-02766-100ug

Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
Keywords: Lymphocyte antigen 6E, Ly6e, Thymic shared antigen 1, Stem cell antigen 2
MW: 22.8 kD
From 266.00€ *
Review
LY6E Protein, Mouse, Recombinant (His & SUMO)
LY6E Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02767-100ug

Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
Keywords: Ly6e, Stem cell antigen 2, Thymic shared antigen 1, Lymphocyte antigen 6E
MW: 24.8 kD
From 320.00€ *
Review
LY6E Protein, Mouse, Recombinant (B2M & His)
LY6E Protein, Mouse, Recombinant (B2M & His)

Item number: TGM-TMPH-02766-10ug

Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
Keywords: Ly67 , Ly-6E , Sca-2 , Tsa-1 , Ly6e , Lymphocyte antigen 6E , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2
MW: 22.8 kD
From 99.00€ *
Review
Ly6e, Recombinant, Mouse, aa21-102, His-B2M-Tag (Lymphocyte Antigen 6E)
Ly6e, Recombinant, Mouse, aa21-102, His-B2M-Tag...

Item number: 374096.100

Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
Keywords: Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1
MW: 22,8
From 690.00€ *
Review
1 from 2 pages