- Search results for GeneID 166863
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 166863"!
Close filters
Filter by:
No results were found for the filter!
NEW
Item number: TGM-TMPH-04580-100ug
Description: RBM46 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q8TBY0.
| Keywords: | RNA-binding motif protein 46 , Probable RNA-binding protein 46 , RBM46 , Cancer/testis antigen 68 (CT68) |
| MW: | 66.9 kD |
From 93.00€
*
Item number: ATA-HPA038431.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA037746.100
Polyclonal Antibody against Human RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Validated applications: ICC, Uniprot ID: Q8TBY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 100% Rat gene identity: 100%
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: CSB-EP851536HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-533aa. Protein Length: Full Length. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: MNEENIDGTN GCSKVRTGIQ NEAALLALME KTGYNMVQEN GQRKFGGPPP GWEGPPPPRG CEVFVGKIPR DMYEDELVPV FERAGKIYEF RLMMEFSGEN RGYAFVMYTT KEEAQLAIRI LNNYEIRPGK...
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 66.9 kD |
From 247.00€
*
Item number: ABS-PQ-3807-L.100
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 64 kD |
From 295.00€
*
Item number: ABS-PQ-3807.100
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 64 kD |
From 270.00€
*
Item number: ATA-APrEST79790.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ATA-HPA079488.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: G-CAB16605.20
RBM46 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB applications.RBM46 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-CT68, Anti-RBM46, Anti-Cancer/testis antigen 68, Anti-RNA-binding motif protein 46, Anti-Probable RNA-binding protein 46 |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
103.00€
*
Item number: CSB-CL851536HU.10
Length: 1602 Sequence: atgaatgaag aaaatataga tggaacaaat ggatgcagta aagttcgaac tggtattcag aatgaagcag cattacttgc tttgatggaa aagactggtt acaacatggt tcaggaaaat ggacaaagga aatttggcgg tcctcctcca ggttgggaag gtccacctcc acctagaggc tgtgaagttt ttgtaggaaa aatacctcgt gatatgtatg aagatgagtt agttcctgta tttgaaagag ctgggaagat...
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Item number: ATA-APrEST95630.100
PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
| Keywords: | CT68, RBM46, Cancer/testis antigen 68, RNA-binding motif protein 46, Probable RNA-binding protein 46 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*